KEGG   Phaeosphaeria nodorum: SNOG_05764Help
Entry
SNOG_05764        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
pno  Phaeosphaeria nodorum
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:pno00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    SNOG_05764
Enzymes [BR:pno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     SNOG_05764
Protein kinases [BR:pno01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   SNOG_05764
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 332 aa AA seqDB search
MDIPRPDNFNECYLYEELMECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHR
DLKPGNLLVNADCELKICDFGLARGFSMDPEENAGYMTEYVATRWYRAPEIMLSFQSYTK
AIDVWSVGCILAELLGGKPFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQDYVRNL
PFMQKISFQSLFRNANPDALDLLDRMLAFDPSSRISVEEALEHRYLQIWHDASDEPTCPT
TFDFQFEVVEEIPEMKTMILAEVNRFRQMVRVQPGAGGQAQNQPPQVPIPNNYDRAGYED
PRPQEAYNQGGGSWQGNDLERDLQGLDGRLRQ
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggacattccccgccccgacaacttcaacgaatgctatctctacgaggagttgatggag
tgcgatctggcagccatcatccgctccggccagcccctcaccgacgcccatttccaatcc
ttcatataccagatcctctgcggtctgaaatacatccactcggccaacgtcctccaccgc
gacctgaagcccggtaatctcctagtcaatgccgactgcgaactcaagatttgcgatttt
ggcttggccagaggtttctccatggacccggaagagaatgcaggatacatgaccgagtac
gtcgcgactcggtggtacagagcgcccgagatcatgttgagtttccagagctacacaaaa
gccatcgatgtatggtccgtcggatgtatcctcgccgagctgctcggtggaaagcccttc
ttcaagggccgcgattacgtcgatcagctgaaccagatcctgcactacctaggcacaccc
aacgaggagaccctttcgcgcatcggctcgccccgtgcccaggactacgttcgcaaccta
ccgttcatgcagaaaatctcattccagtcattgtttaggaacgccaaccccgatgccctg
gatctcctcgatcgcatgcttgcctttgatccttccagccgcatctctgtcgaggaagca
ctcgaacacaggtacttgcaaatctggcacgacgcttcagacgagccaacatgccccacg
acattcgactttcagtttgaggtcgtcgaggaaatacccgagatgaagacgatgattctc
gctgaagtcaaccgcttccgccaaatggtccgtgtccagcctggtgccggtggccaagct
cagaaccagccgcctcaggtcccgatacctaacaactacgaccgcgctggctacgaagat
ccaaggccgcaagaggcatacaaccagggtgggggtagctggcagggcaacgatttagaa
cgcgatttgcagggtcttgatggaaggctgagacagtga

DBGET integrated database retrieval system