KEGG   Parastagonospora nodorum: SNOG_05764Help
Entry
SNOG_05764        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
Organism
pno  Parastagonospora nodorum
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 332 aa AA seqDB search
MDIPRPDNFNECYLYEELMECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHR
DLKPGNLLVNADCELKICDFGLARGFSMDPEENAGYMTEYVATRWYRAPEIMLSFQSYTK
AIDVWSVGCILAELLGGKPFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQDYVRNL
PFMQKISFQSLFRNANPDALDLLDRMLAFDPSSRISVEEALEHRYLQIWHDASDEPTCPT
TFDFQFEVVEEIPEMKTMILAEVNRFRQMVRVQPGAGGQAQNQPPQVPIPNNYDRAGYED
PRPQEAYNQGGGSWQGNDLERDLQGLDGRLRQ
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggacattccccgccccgacaacttcaacgaatgctatctctacgaggagttgatggag
tgcgatctggcagccatcatccgctccggccagcccctcaccgacgcccatttccaatcc
ttcatataccagatcctctgcggtctgaaatacatccactcggccaacgtcctccaccgc
gacctgaagcccggtaatctcctagtcaatgccgactgcgaactcaagatttgcgatttt
ggcttggccagaggtttctccatggacccggaagagaatgcaggatacatgaccgagtac
gtcgcgactcggtggtacagagcgcccgagatcatgttgagtttccagagctacacaaaa
gccatcgatgtatggtccgtcggatgtatcctcgccgagctgctcggtggaaagcccttc
ttcaagggccgcgattacgtcgatcagctgaaccagatcctgcactacctaggcacaccc
aacgaggagaccctttcgcgcatcggctcgccccgtgcccaggactacgttcgcaaccta
ccgttcatgcagaaaatctcattccagtcattgtttaggaacgccaaccccgatgccctg
gatctcctcgatcgcatgcttgcctttgatccttccagccgcatctctgtcgaggaagca
ctcgaacacaggtacttgcaaatctggcacgacgcttcagacgagccaacatgccccacg
acattcgactttcagtttgaggtcgtcgaggaaatacccgagatgaagacgatgattctc
gctgaagtcaaccgcttccgccaaatggtccgtgtccagcctggtgccggtggccaagct
cagaaccagccgcctcaggtcccgatacctaacaactacgaccgcgctggctacgaagat
ccaaggccgcaagaggcatacaaccagggtgggggtagctggcagggcaacgatttagaa
cgcgatttgcagggtcttgatggaaggctgagacagtga

DBGET integrated database retrieval system