KEGG   Phaeosphaeria nodorum: SNOG_05850Help
Entry
SNOG_05850        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K02304  
precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
pno  Phaeosphaeria nodorum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SNOG_05850
Enzymes [BR:pno01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     SNOG_05850
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     SNOG_05850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 247 aa AA seqDB search
MKGPYPEIQGGGSLLLAWQIRNKRVLIVGGGEVAAGRIVNILNADAKITVVSPRDGLNDE
VAYRIEQKQVDYVDRKFEPSDLDGVDMVLTAVDDPEASSQIFKLCKEKKIAANIADVPPE
CDFYFGSVHRDGPLQIMVSTNGNGPKLANIVRRQIAAGLPKNIGNAVQQVGMLRKKLRKV
APNIEEGPKRMQWMSKVCEQYTLDDLCSMTQEDMEMLLGFYKPNTVPTLEQLRLQEPDGA
FDGPFLI
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcccataccccgagatccaaggcggaggctccctcttgctcgcctggcagata
cggaacaagcgcgtactgattgtcggtggaggagaagtcgcggctggtcgcatcgtgaac
atcctcaacgccgacgccaaaatcaccgtcgtctcgccacgtgacggtctcaacgatgaa
gtcgcataccgcatcgagcagaagcaggtcgattacgtcgaccgcaagttcgaaccatcc
gacctcgatggcgttgacatggtcttgaccgccgtcgacgaccctgaagcctcgtcacaa
atattcaagctgtgcaaggagaagaagatcgccgccaacattgcagacgtgccgcccgag
tgcgacttctactttggcagcgtgcatcgcgacgggccgctgcagatcatggtcagcacc
aatggcaacggtcctaagctggccaacattgtgcggcggcagatcgcggcggggctgcca
aagaacatcggcaacgccgtgcagcaagtaggcatgctgcggaagaaactgcgcaaggtc
gcgcccaacatcgaggaggggccgaagaggatgcaatggatgtccaaagtctgcgaacag
tacacgcttgacgacctttgctcaatgacgcaagaggacatggagatgctgcttggtttc
tataagccaaataccgttcccacgctcgagcagctacggctgcaagaacctgacggagca
tttgacgggccgttcctgatctag

DBGET integrated database retrieval system