KEGG   Phaeosphaeria nodorum: SNOG_05978Help
Entry
SNOG_05978        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
pno  Phaeosphaeria nodorum
Brite
Enzymes [BR:pno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     SNOG_05978
Peptidases [BR:pno01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   SNOG_05978
Exosome [BR:pno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SNOG_05978
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 263 aa AA seqDB search
MHAQSILAALAVPALVYGAAIPQEFPENWDETSEDIVGGVTAAQGDVPFIVSVSLSGVGH
YCGGSLINANTVVSAAHCYQGETATDFSVRAGSLNKNSGGTTSAVASIVIHPSYNSRTSD
NDIAIIKLRTPIATSSTISYASLAASGQDPAAGTTLTVAGWGATTQGGGSPTTLRKVDVP
VVARTTCRSRYSTIGLSVTDQMFCAGFTAGGKDSCQGDSGGPIITSSKQLVGIVSWGEGC
AQPNFPGVYSRVGSLTSFISANL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcccaatccatcctcgccgcccttgcggttcctgccctcgtctacggtgctgcc
atcccccaggagttccctgagaactgggatgagacttccgaggacatcgttggtggtgtc
accgctgcccagggtgacgtgcctttcatcgtcagcgtttcgctgagcggtgttggccac
tactgcggaggctctctcatcaacgccaacacggttgtcagtgcagctcactgctaccaa
ggcgagacggccactgacttcagcgttcgtgctggatccctcaacaagaactccggcggt
actacctctgctgttgcttccattgtcattcacccgagctacaacagccgcacttcggac
aacgacattgccattatcaagctcaggacccccattgcgactagctctaccattagctac
gcatcccttgccgcttccggccaggaccctgctgctggtaccactctgaccgtcgccggc
tggggtgctactactcagggtggcggtagccctaccacgctccgcaaggtcgatgtgccc
gttgttgcgcgcaccacttgccgcagccggtactccaccattggcctctccgttaccgac
cagatgttctgcgctggtttcaccgccggtggaaaggactcttgccagggtgactctggc
ggccccatcatcacctcctccaagcagctcgtcggtatcgtctcttggggtgagggctgc
gctcagcccaacttccccggtgtctactccagggttggctctcttacttctttcatctct
gccaacttgtaa

DBGET integrated database retrieval system