KEGG   Phaeosphaeria nodorum: SNOG_06196Help
Entry
SNOG_06196        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pno  Phaeosphaeria nodorum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SNOG_06196
Enzymes [BR:pno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SNOG_06196
Exosome [BR:pno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SNOG_06196
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 550 aa AA seqDB search
MEKLSAQETNPQPIPKEQVADTQDGSQLDEEKLKNFFIGSIDQGTTSTRFIIFDGLGEPV
AQHQIEFTQKYPQSGWHEHDPKEIIASVEECMERATSIFVDMEHEISDIKAIGITNQRET
TVVWDTHTGEPLYNAIAWPDTRTKGLVRELKARDGADKLQDMCGLPLSTYPSSVKLMWLL
QHVDAVKEAYDEGRLSFGTIDTWILYNLNGGKERDLHVTDTTNASRTMFMNLHTVQYDDQ
LLEFFGLDQKKLNLPKIVPSSSPDAFGSIQKGELKGIRIAGCLGDQSSALVGQQGFTPGA
AKNTYGTGCFLLYNVGEKPVISHHGLLATVAYDFGGKRKPVYALEGSIAVAGSGVKFLMN
NMGFITHSHKISDLAASVQDNGGCVFVTAFSGLFAPYWIDDAKGTIFGITQFTERGHIAR
ATLEATCFQTKAILDAMEKDSGHKLNMLAVDGGMSNSNLCMQTQANIIGIPVDRPAMRET
TALGAAIAAGFAVDVWKEFDELKEINQKDRVIFEPNISREEGAKMFKKWGRAVEMCRGWL
DADEQNGEFS
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaactctctgcccaggagacgaatccgcaaccgataccaaaggagcaggttgca
gacacccaagatggatcacaactcgatgaagaaaagctcaagaacttcttcatcgggtct
attgatcaaggaaccacaagtacgcgcttcatcatcttcgacgggttaggcgagcctgtc
gcacaacatcagattgaattcacccagaaatatccccagtcaggatggcacgagcacgac
ccgaaggaaatcatcgcctcggttgaagagtgcatggaacgagcaacttcaatctttgtt
gacatggagcatgaaatttctgacatcaaggccattggcataaccaatcagcgtgaaacc
actgtggtgtgggacactcatacgggcgagccattgtacaatgctattgcttggccagat
acgagaaccaagggcttggttcgcgagctcaaagccagggatggtgcggataaactgcaa
gacatgtgcgggctcccgctttcgacatatccctcatcggtgaagctcatgtggctgctt
caacacgttgatgcggttaaagaggcatacgatgaaggccgcctgtcattcggcacaatc
gacacctggatcctgtacaatctcaatggaggaaaggaaagagatcttcacgtgacggac
acgacaaacgcctctagaactatgtttatgaatttgcacacggtgcagtacgacgatcaa
cttctagaattttttgggctggaccaaaagaagctgaaccttccaaaaattgttccctcg
tcgtcaccggacgctttcggttccatccagaaaggagagttaaaaggcattcggattgca
ggatgcttaggggatcagtcttctgcattggttggccaacaaggcttcacgcctggcgcc
gcgaaaaacacttatggcaccggttgcttcttgctttataatgttggcgagaagccagtg
atatcccatcatggcttgctggctacggttgcatacgattttggcggtaagcgcaagcct
gtgtatgcgcttgagggaagtattgctgtcgctgggagtggtgtaaaattcttgatgaac
aacatgggcttcataactcactcacacaagatcagtgatctcgcagcaagtgtgcaagac
aacggtggatgcgtcttcgtcactgccttctccgggcttttcgccccgtactggattgat
gacgccaagggcaccattttcggcatcactcagtttactgagcggggtcatattgctaga
gcgacccttgaggcgacttgcttccagacgaaggctattcttgacgccatggagaaggac
agcggccacaagcttaacatgcttgcggtagacggaggcatgtcgaactcaaatctgtgc
atgcagactcaagcaaacattattggtattcccgtcgatcgaccagcaatgcgcgagaca
actgcccttggtgctgcaatcgcagctggcttcgccgttgatgtgtggaaagagtttgac
gaactaaaagagatcaaccagaaagatcgagtgatctttgaaccaaacattagcagagag
gaaggtgcaaaaatgttcaagaagtggggcagagcagtcgaaatgtgcaggggttggctc
gacgctgacgagcagaacggcgagttttcatga

DBGET integrated database retrieval system