KEGG   Phaeosphaeria nodorum: SNOG_06350Help
Entry
SNOG_06350        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
pno  Phaeosphaeria nodorum
Brite
Enzymes [BR:pno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     SNOG_06350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1008 aa AA seqDB search
MAEPGRLMGQTASNADPDDIDADGDYEMDDEYEQEQVAGAQISQLDGHSTDAEGSDVDAE
GAVKIALRRPASSDEEDDYNDEEAVAHSSDAKTSDSEDESGAESEEEAPWQAESENGEEV
EAARSDPNVCIYCNQDEENDPSPEYEEYLSCGVCGDNGYHLVPKLARDLLPSHRGVDPGG
HSIFKEPHSSLTMPQTALTGFKGKRKASHEEEPVAQPSRGNRNKQRPSEASKSPVGGTSV
NASSPALRPKSARSARSAITEAHDTEGEAQQTASDNDDEDDETRTRSRPRRSKMKRSNDK
RPLAWIEEQQGLSLIMAFHLNNEKVQKIVTAKPKKKVLTIEQERQERRRERDRERRERNR
RAAQAARESPELTHYPAVPIHYSTPFHGFSEKEDESKSKPYGGVLSEADADTSKTYPSQA
DRKRFEEARVKAEEEWKEKQDTLYAHLDVIKPSKQTATASKIKCVNFGGWEIDTWHAAPY
PEEYSKNRVLYICEFCLKYMNSDYVAWRHKLKCPAKHPPGDEIYRDGKYSFFEVDGRKNP
VYCQNLCLLAKLFLGSKTLYYDVEPFLFYVMTENDNYGCHFVGYFSKEKRPSSLNNVSCI
LVLPIHMRKGYGQYLIEFSYLLTRVERKTGSPEKPLSDMGLVSYRKYWRLVLCEELLQQK
GPISISAISDRTGMTADDIVSALEGLRALVRDPVTKKYAFRLDTGYFKQYIEKCNAADNP
KINPDCLLWTPYVMGRLGQYEDGPALQTVQQRDEVEEEEKPVPEEGVQMDAAAKQNGSTQ
DQDGGTGDEADPSVPALPAEDSVNGGSPAPGTPLANGSTIALAGSQMATSEPAIPPSRYE
IFPPIPGQPASRRRPGRPFGTRRRTSTPNRARNTPLSIHTAPVSKIQLSPSRIAKGSPSN
GALTPGTILRRTRSRLGESVTNGDDVEEGGAVKAVLTNGRRSTRSSASSLGSPRVGKDIK
GKGKALPVEEEQDDPDADADGDYDEEADEGMDIDAEGEDDDDIIMAGA
NT seq 3027 nt NT seq  +upstreamnt  +downstreamnt
atggcggagcccggtaggctcatgggccaaaccgcgagcaacgccgacccagacgacatc
gatgctgatggcgactacgagatggacgacgagtacgagcaggaacaggtcgcaggtgca
cagatatcacaacttgatggccacagcacagacgccgaaggctccgacgtggatgctgaa
ggcgctgtcaagattgccctgcgccggcctgcctcttcagatgaggaggacgactacaac
gacgaagaggctgtggcccactcctctgacgccaagaccagcgacagcgaagacgagtca
ggcgccgagtcagaagaggaagccccgtggcaggccgagagtgagaatggggaagaagtc
gaggctgccagatctgatcccaatgtgtgcatctactgcaaccaggacgaagagaatgat
ccaagtccagaatatgaagagtatttgtcatgcggcgtgtgtggtgacaatggttatcat
cttgtgcccaagctggctagggacctgcttccgtcacatcgcggtgtcgatccaggcggc
cactctattttcaaggaacctcattcttccttgacgatgccccagacggcactaacgggc
tttaagggaaaacgaaaggcctcacacgaggaagagccagtggcgcagcccagccgcggg
aacagaaacaaacagaggccgtcagaagcttccaaatcaccggttggcggaacctcagtg
aatgcgtcatcccctgcactacgaccaaaaagcgctagaagcgctcgcagtgctatcacc
gaggctcatgatacagaaggcgaagcgcaacaaactgcttctgacaacgacgacgaggac
gacgagactcgtacacgatcgcgcccaaggcgctctaagatgaagaggtcaaacgacaaa
agaccgcttgcgtggatcgaggagcaacaaggcttgagtctaatcatggcctttcacctc
aataatgagaaagttcagaagattgttacggcaaagcccaagaagaaggttcttaccata
gaacaagagcgccaggagcgacggcgcgaacgagacagggagaggcgcgaacgaaatagg
cgcgctgcgcaggccgccagagagtcgccggagctcactcactatcctgctgtcccaata
cattatagcacaccattccacggtttctcggaaaaggaagacgagagcaagagcaaacca
tatggcggtgtgctctccgaggccgatgctgacacgtcgaaaacatatccctcgcaggct
gatcggaaacgattcgaagaagcccgagtaaaagcagaggaagagtggaaagagaagcaa
gacacactctacgctcacctcgacgtcataaagccatcaaagcagacagccaccgcgagc
aagatcaagtgcgtcaactttggtgggtgggaaatcgacacctggcacgctgcgccctat
ccggaagaatatagcaagaatagggtgctttacatctgcgagttctgtttgaaatacatg
aactcggactatgtggcatggcggcacaagctcaagtgccctgcaaagcacccaccaggc
gacgaaatctatcgtgacggcaagtactccttcttcgaagtggacggcaggaagaatcca
gtctactgccaaaacctctgtcttttagcgaagctcttcctcggctccaagacgctctac
tacgatgtggaaccattcctcttctatgtcatgacagagaacgacaactatggatgtcac
ttcgttggctacttctcaaaggaaaagaggcctagctcactcaacaacgtgtcctgtatt
ctcgtgctacccatccacatgcgcaagggatacggacagtatctgattgagttctcatat
ctcctcacacgggtagagaggaaaactggaagtcccgaaaagcctctcagtgacatgggt
ctagtaagttaccggaaatactggcgacttgttctctgcgaagagctgctacaacagaag
gggccgatcagcatatcagccatctcagaccgaacgggcatgacagcggacgatatcgtg
tccgcgctggaaggtctgcgcgctcttgtgcgcgaccctgtcacgaagaaatacgcattc
cgactagatacgggctatttcaagcagtacatcgaaaagtgcaatgctgcagacaacccg
aagatcaatcccgattgcttgttgtggacgccatatgttatgggtcgactaggtcaatat
gaggacggacctgctttgcagaccgtacagcagcgtgatgaagtcgaagaggaagagaag
ccggtgcccgaagagggcgtgcagatggacgccgcagccaaacagaacgggtcaacacaa
gaccaggacggcgggactggcgacgaagcggatccatcagtacctgcactcccagctgaa
gactccgtcaatggcggttcaccagctccaggcacacctcttgcgaacggctccacgatc
gcacttgcgggatcacaaatggccaccagcgaacccgcgattccaccctcgcgttacgag
atcttccctccgatacctggccaaccggcatctagacgccgacctggccgcccattcgga
acacggcggcgcacaagcacaccaaatcgagctcgtaatacccccctctccatccacaca
gcccctgtatccaagatccaactttctcccagccgcatcgcaaaaggctctccctcgaac
ggcgcgctcacgcctggtactattctccgccgcacgcgtagtcgactgggcgaaagcgtc
acgaatggcgacgacgtcgaagaaggcggtgccgtcaaagccgtcctcaccaacggccgg
cgaagcacaagaagttcagcaagctcgctgggtagtccccgcgtcggcaaagacatcaag
ggcaaaggcaaggcgctacccgtcgaagaagagcaggacgacccagacgccgatgctgac
ggcgattacgacgaagaagcagacgagggaatggacattgacgccgaaggcgaagacgat
gacgatattatcatggcgggcgcttag

DBGET integrated database retrieval system