KEGG   Parastagonospora nodorum: SNOG_06435Help
Entry
SNOG_06435        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K13333  lysophospholipase [EC:3.1.1.5]
Organism
pno  Parastagonospora nodorum
Pathway
pno00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SNOG_06435
Enzymes [BR:pno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SNOG_06435
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B
Motif
Other DBs
NCBI-GeneID: 5973685
NCBI-ProteinID: XP_001796806
UniProt: Q0UP79
Position
Unknown
AA seq 654 aa AA seqDB search
MKYSLVLTASAFTTLVTSSAVVAREARVVPPTNLDSWKRASPQAPNGYAPGSIDCPSTRP
SIRSADRLSDSETQWLQKRRPKTVDPMREFLVRANIEGFDAGQYIDNHKSNTSSLPNIAI
SFSGGGYRALLNGAGVLAAFDSRTPNATSKGHLGGLLQASTYVSALSGGGWMIGSIFANN
FTSVQNIIDHKDIWQFQNSLFKGPPEGGIQILNTADYFKNLADTVSSKENAIGEFNTSLT
DYYGRGLSFQLINASDGAPAYTFSSIQSDTSFSNGEAPMPVLVADERAPGEKLISLNATV
IEFNPFEMGSFDPTLYGFAPTRYLGSNFSNGQLPQDQGCIAGFDNLGFVMGTSSSLFNQI
FLNLGSLGIPDFLKNTLTGILGSVGEDNNDIADYTPNPFRGFRNGTNPSANSTRLTLVDG
GEDLQNIPLNPVIQPMRQVDVIFAVDSSADTVEDANPSKNWPNGTAMVATYQRANTDIMN
KTSFPYVPGQDTFVALGFNNRPAFFGCNSSNVTEGNNIPPLIVYVPNSPYVFWSNTSTFG
KLDYTIAERNAMIENGYDVATQANSTRQGATNWPACVGCAILSRSFERNGQQIPQACQQC
FTEYCWNGTTVSNSAPYQPAMILAAVDTKSGVGKFAPNVFGLAVAAAVSGFLMM
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgaagtactccttagtgttgactgcgtcggctttcacgaccttagtgacctcatcagca
gttgtcgcacgtgaggctcgagttgtgccacctaccaacttggactcgtggaaacgagcg
tcgccccaagctcccaacggctacgcgccgggctcgattgactgcccttcgacccgcccc
agcattcgctccgccgaccgcctctccgattcagagacacaatggctacagaagaggaga
ccgaagacggtagacccgatgcgcgagttcctcgtgcgcgcgaacatcgagggcttcgac
gctggacagtacatcgataaccacaagagcaacacttcatctctaccgaacattgctatt
tcattctcaggcggaggctaccgagctttgttgaacggagctggtgttcttgctgcgttt
gacagccgcacgccaaacgcgacaagcaagggacatcttggaggtctgctgcaagcctcg
acatacgtctctgctttatcaggaggaggctggatgattggtagcatatttgcgaacaac
tttacatctgtgcaaaacatcatagaccacaaggacatttggcagttccagaactcgttg
ttcaagggaccaccagagggcggcatccagatcctgaacactgcggactacttcaagaac
ttggcggataccgtgtcctccaaggaaaatgcgattggggagttcaacacttcgttgacc
gactactacggccggggactctcgttccagctcatcaatgcttccgatggcgcccctgcc
tacaccttctcttcaattcagagcgataccagcttttccaatggcgaagcaccgatgccg
gtattggtagcggatgaacgagctcctggcgaaaagctcatctcccttaacgccactgtt
atcgagttcaacccatttgaaatgggctccttcgaccctactctctacggcttcgcgccg
acgagatatcttggctcaaacttctccaacggccaacttcctcaggaccagggttgcatt
gcaggtttcgacaaccttggtttcgtcatgggaacgagcagttcgctctttaaccagatc
ttcttgaacctcggttcgctggggatacctgactttttgaagaacacactcactggtatc
ctgggctccgttggtgaggacaacaacgatatcgcagactacacccccaacccattcagg
gggttccgcaacggcacgaacccaagtgcgaacagcacacgcctgactcttgttgacggt
ggagaggatttgcagaacatccctcttaaccctgttatccagcccatgcgccaggtagat
gtcattttcgccgtcgactcgtctgcagacacggtcgaagacgccaacccttccaaaaat
tggcccaatggaaccgccatggtcgcgacctaccagcgtgccaataccgacatcatgaat
aagacttcgttcccttacgtcccgggtcaggacacctttgtcgcccttggcttcaacaac
cgccctgctttctttggatgcaacagcagcaacgtaacggagggcaacaacatcccgccg
ctcattgtctacgtcccgaactcgccttatgtgttttggtcaaacacgtcgacctttgga
aagctcgactacaccattgcggagcgcaatgcaatgatcgagaacggctacgacgttgct
acccaggccaactctacccgccagggcgctacaaactggccggcttgtgtcggctgcgcc
attctgtctaggagcttcgagcgcaacggtcagcagattccgcaggcctgccagcagtgc
ttcaccgagtactgctggaacggcactactgtctccaactcggcgccatatcaacctgct
atgatcttggctgctgttgacacgaagagtggtgtcggcaagtttgcgccaaatgtgttt
ggtcttgctgtcgcagctgccgtgtctggtttcttgatgatgtag

DBGET integrated database retrieval system