KEGG   Phaeosphaeria nodorum: SNOG_06435Help
Entry
SNOG_06435        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
pno  Phaeosphaeria nodorum
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:pno00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 654 aa AA seqDB search
MKYSLVLTASAFTTLVTSSAVVAREARVVPPTNLDSWKRASPQAPNGYAPGSIDCPSTRP
SIRSADRLSDSETQWLQKRRPKTVDPMREFLVRANIEGFDAGQYIDNHKSNTSSLPNIAI
SFSGGGYRALLNGAGVLAAFDSRTPNATSKGHLGGLLQASTYVSALSGGGWMIGSIFANN
FTSVQNIIDHKDIWQFQNSLFKGPPEGGIQILNTADYFKNLADTVSSKENAIGEFNTSLT
DYYGRGLSFQLINASDGAPAYTFSSIQSDTSFSNGEAPMPVLVADERAPGEKLISLNATV
IEFNPFEMGSFDPTLYGFAPTRYLGSNFSNGQLPQDQGCIAGFDNLGFVMGTSSSLFNQI
FLNLGSLGIPDFLKNTLTGILGSVGEDNNDIADYTPNPFRGFRNGTNPSANSTRLTLVDG
GEDLQNIPLNPVIQPMRQVDVIFAVDSSADTVEDANPSKNWPNGTAMVATYQRANTDIMN
KTSFPYVPGQDTFVALGFNNRPAFFGCNSSNVTEGNNIPPLIVYVPNSPYVFWSNTSTFG
KLDYTIAERNAMIENGYDVATQANSTRQGATNWPACVGCAILSRSFERNGQQIPQACQQC
FTEYCWNGTTVSNSAPYQPAMILAAVDTKSGVGKFAPNVFGLAVAAAVSGFLMM
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgaagtactccttagtgttgactgcgtcggctttcacgaccttagtgacctcatcagca
gttgtcgcacgtgaggctcgagttgtgccacctaccaacttggactcgtggaaacgagcg
tcgccccaagctcccaacggctacgcgccgggctcgattgactgcccttcgacccgcccc
agcattcgctccgccgaccgcctctccgattcagagacacaatggctacagaagaggaga
ccgaagacggtagacccgatgcgcgagttcctcgtgcgcgcgaacatcgagggcttcgac
gctggacagtacatcgataaccacaagagcaacacttcatctctaccgaacattgctatt
tcattctcaggcggaggctaccgagctttgttgaacggagctggtgttcttgctgcgttt
gacagccgcacgccaaacgcgacaagcaagggacatcttggaggtctgctgcaagcctcg
acatacgtctctgctttatcaggaggaggctggatgattggtagcatatttgcgaacaac
tttacatctgtgcaaaacatcatagaccacaaggacatttggcagttccagaactcgttg
ttcaagggaccaccagagggcggcatccagatcctgaacactgcggactacttcaagaac
ttggcggataccgtgtcctccaaggaaaatgcgattggggagttcaacacttcgttgacc
gactactacggccggggactctcgttccagctcatcaatgcttccgatggcgcccctgcc
tacaccttctcttcaattcagagcgataccagcttttccaatggcgaagcaccgatgccg
gtattggtagcggatgaacgagctcctggcgaaaagctcatctcccttaacgccactgtt
atcgagttcaacccatttgaaatgggctccttcgaccctactctctacggcttcgcgccg
acgagatatcttggctcaaacttctccaacggccaacttcctcaggaccagggttgcatt
gcaggtttcgacaaccttggtttcgtcatgggaacgagcagttcgctctttaaccagatc
ttcttgaacctcggttcgctggggatacctgactttttgaagaacacactcactggtatc
ctgggctccgttggtgaggacaacaacgatatcgcagactacacccccaacccattcagg
gggttccgcaacggcacgaacccaagtgcgaacagcacacgcctgactcttgttgacggt
ggagaggatttgcagaacatccctcttaaccctgttatccagcccatgcgccaggtagat
gtcattttcgccgtcgactcgtctgcagacacggtcgaagacgccaacccttccaaaaat
tggcccaatggaaccgccatggtcgcgacctaccagcgtgccaataccgacatcatgaat
aagacttcgttcccttacgtcccgggtcaggacacctttgtcgcccttggcttcaacaac
cgccctgctttctttggatgcaacagcagcaacgtaacggagggcaacaacatcccgccg
ctcattgtctacgtcccgaactcgccttatgtgttttggtcaaacacgtcgacctttgga
aagctcgactacaccattgcggagcgcaatgcaatgatcgagaacggctacgacgttgct
acccaggccaactctacccgccagggcgctacaaactggccggcttgtgtcggctgcgcc
attctgtctaggagcttcgagcgcaacggtcagcagattccgcaggcctgccagcagtgc
ttcaccgagtactgctggaacggcactactgtctccaactcggcgccatatcaacctgct
atgatcttggctgctgttgacacgaagagtggtgtcggcaagtttgcgccaaatgtgttt
ggtcttgctgtcgcagctgccgtgtctggtttcttgatgatgtag

DBGET integrated database retrieval system