KEGG   Phaeosphaeria nodorum: SNOG_06636Help
Entry
SNOG_06636        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pno  Phaeosphaeria nodorum
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SNOG_06636
Enzymes [BR:pno01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     SNOG_06636
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 303 aa AA seqDB search
MVDRANRPSALSAPKAEAPGAQVEIIGQGGSQKVVATLASGESVEVLLFGATVTSWKSHG
GKTENLWLSEKADLTGTKAVRGGIPVVFPHGFARASRWEFLGKSDTEAASESDSVKLDFG
LDRSGLSDEARKAWPLDFGLVYSVTLSKGSLQTMMTVRNEGEESFEFQFLLHSYWKISDI
SKVSVTGLSGTEYVDKVLDAGTYQQKDNALKFTGEVDRVYKAIPQDTTSILEDGKPRFDV
IRDNVKDTVTWNPWIEKAKAMGDFSPDDGYKTMVCIEIGAVDGWQKLEKGEVWEGGQLVK
SLL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaccgcgcgaaccgccccagcgctctcagcgcacccaaggccgaagcacccgga
gctcaggttgagatcattggacaaggaggaagccagaaggtcgtcgccacacttgcctcg
ggcgagagcgtcgaggtgttgctatttggagctaccgtgacgagctggaagagccatggc
ggcaagacggagaacctgtggttgagcgagaaggcagacttgactggcaccaaggctgtc
cgcggcggcattcccgtcgtgttcccgcacggtttcgctcgcgcatcacgctgggagttc
cttggcaagtccgacacagaggctgcctcagaatcagactcggtcaagctcgacttcggc
ctcgacaggtcgggactcagcgatgaggcgcgcaaggcgtggcctctggactttggcctg
gtctacagcgtcacattgagcaagggcagtctgcagactatgatgacggtccgcaatgag
ggcgaggagagcttcgagttccagttcttgctgcacagctactggaagatttcggacatc
tccaaggtcagcgtcaccggcttgtccggcaccgagtacgtcgacaaggtcctcgacgca
ggtacataccagcagaaggacaacgccctcaagttcacgggcgaagtcgaccgcgtctac
aaggcgatcccacaggacacgacctccatcctcgaggatggcaaaccccgcttcgatgtc
atccgcgacaacgtcaaggacacggtcacctggaacccgtggatcgagaaggcaaaggcc
atgggcgacttctcgccagacgacggctacaagaccatggtctgtatcgagattggcgct
gtggacggctggcagaagttggagaaaggcgaggtttgggagggcggtcagttggtcaag
agcttgctgtaa

DBGET integrated database retrieval system