KEGG   Phaeosphaeria nodorum: SNOG_06886Help
Entry
SNOG_06886        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pno  Phaeosphaeria nodorum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pno01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pno00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:pno00750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 551 aa AA seqDB search
MSSHTTSQRYLSTRGGSYDLSFEEVVLKGLASDGGLFIPEEIPTLPDNWASTWKDLSFED
LAYEIFSLYISSSEIPPADLKDIIRRSYATFRTKDVAPTVTIDKEKNIHLLELFHGPTFA
FKDVALQFLGNLFEYFLVRKNEGKSGRNREHLTVVGATSGDTGSAAIYGLRGKKDVSVFI
MFPHGKVSPIQEAQMTTVIDANVHNLAVDGTFDDSNALQDFVKALFADPEINKTHRLAAV
NSINWARILAQITYFFYSYFNLIKSPSFLPASTVRFVVPTGNFGDILAGFFAKRMGLPAE
KLVIATNANDILHRFWESGRYEKHAVHGKQAEGGLPEDGAKAHESGVKETLSPAMDILVS
SNFERLLWFLAYEVYSTNSDAVSQRRSQAGDHVRGWLNDLKSKGGFAVDPQILKAAQADF
ASYRVSDDETIDMIKYIFSAEASKSYVLDPHSAIGVAAALRSAEVSKPPSTHHIALATAH
PAKFANAVELALPEQKEYFQAKVLPAEFKGLEDLPRRVSHVKRSEGWEGVRKVVIAEVEA
ELQAAEKEGKL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgcataccacatctcagcgctacttgagcacccggggaggatcctacgatctg
tctttcgaggaagtcgtgctgaagggtcttgcctcagatggcggccttttcatcccagag
gagattcccacactgcccgataattgggcgtcgacgtggaaagacctgtccttcgaggac
ctcgcatacgaaatcttctccctctacatctcgtcgtctgagataccgcccgcagacctg
aaggatatcatccgtcgcagctatgccacattccgcacgaaggacgttgcaccaaccgtc
acgatcgacaaggagaagaacatacatctgctagagctgttccacggacctacgttcgct
ttcaaagatgtcgcactgcagttcttgggcaatctgttcgagtacttcctggtccgcaag
aacgagggcaagagtggacgcaacagggagcacctgaccgtcgttggcgcaacgagtgga
gacactggttctgcagccatctatggtctgcgtggaaagaaggatgtgtcagtcttcatc
atgttcccacatggcaaagtcagcccgattcaagaggcacagatgacgacggtcatagac
gccaacgtgcacaacttagcggtggatggcacattcgacgactctaacgctcttcaggac
ttcgtcaaagctctcttcgcagaccctgagatcaacaagacgcaccgccttgccgccgta
aactccatcaactgggcccgtatcctcgcccagatcacctacttcttctactcgtacttc
aaccttatcaagtcaccttccttcctcccagcgtccaccgtccgcttcgtggtaccgact
ggcaacttcggcgatatccttgcaggcttctttgcgaagcgcatgggtctcccggcggag
aagctggtgattgcgacgaacgcaaacgacattctacaccgattctgggagtctggcaga
tacgagaagcatgcggtgcacggaaagcaagccgagggcgggctgccagaggacggcgcc
aaggcgcatgagagcggtgtgaaggagaccttgagcccggccatggacatcctcgtctcg
tccaactttgagcgcttactctggttccttgcctacgaagtctacagcacaaactccgat
gcggtcagccagcgacgaagccaagccggcgaccacgtccgagggtggttgaacgatctc
aagtccaagggtggctttgctgttgacccgcagatcctcaaggccgcgcaagcagacttc
gcctcataccgtgttagcgatgatgagaccatcgacatgatcaagtacatcttcagcgca
gaggcatcgaagagctacgtcctggacccacattctgccattggtgttgcagcagcactt
cgctcggcggaggtctcaaaacctccttccacacaccacattgcgcttgccactgcgcat
ccggctaagttcgcaaacgctgtcgagctggcgctaccggagcagaaggagtacttccag
gccaaggtgttgccagctgaattcaagggtcttgaggatctgcctcgaagagtcagccat
gtcaagcgctctgagggctgggaaggtgtgcgcaaggtcgttattgcggaagtagaggca
gagctacaggctgctgaaaaggagggtaaattgtag

DBGET integrated database retrieval system