KEGG   Phaeosphaeria nodorum: SNOG_07099Help
Entry
SNOG_07099        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
pno  Phaeosphaeria nodorum
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:pno00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SNOG_07099
   03420 Nucleotide excision repair
    SNOG_07099
   03430 Mismatch repair
    SNOG_07099
   03440 Homologous recombination
    SNOG_07099
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 281 aa AA seqDB search
MCLFIDTYMLIWLRLQRGAGGGAGGGGFIPGDGSQQSPGGRREHTQDSLRPVTIKQLLDA
QLEAGSNDTFKIDGSPVSQLTFVGQIRNISTQTTNTTYRLDDGTGSIEVKQWVDSDTVDQ
TNPTKAKLVEGAYCRAWGKLKSFNDRRSVGAQIIRPVEDMNEVSYHLLEATSVHLFFTRG
PPGGANTGTGAAAVTNGGGQQGTGGGDYGGYDLRTLTPAARKVFNYLRSTEQSNEGIHQH
AISAQLGMDTADVARAGDDLLAGGLIYTTVDDQTWAVLEAE
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtgcctcttcattgatacatacatgctgatttggcttagactacaacggggtgcaggc
ggcggcgccggtgggggaggcttcattcccggagatggcagccagcaaagcccaggaggc
aggcgcgaacacacccaggattcgctgcgtcccgtgactatcaaacagttgctggatgct
cagctcgaggctggcagcaacgacacgttcaagattgacggttcaccggtttcacaactt
accttcgtcggtcaaatacggaacatctcaacacaaacaacgaacaccacctacaggctg
gacgacggaaccggcagcattgaagtcaagcaatgggttgactcagacacggttgaccag
accaaccctacaaaggcgaagctcgtcgagggcgcatattgtagagcatggggcaagctg
aagagctttaacgatcggagatctgtcggtgcgcaaatcattcggccggtcgaggacatg
aacgaagtctcttaccatctgcttgaagccacatcagtacatctgttcttcacccgagga
cctcctggtggtgcaaacacgggcactggtgctgctgccgtcaccaacggaggtggacaa
caggggactggaggcggtgattatggtggctatgacctgcgcactctgactccggctgcg
aggaaggtgttcaactacctgagatcaacggagcagtcgaacgagggcattcaccaacat
gctatttcggcacaactcggcatggacacggcagatgtagccagggctggagacgacttg
ttggctggtggtctcatctacaccaccgtggacgatcagacctgggctgtcctcgaggca
gaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system