KEGG   Phaeosphaeria nodorum: SNOG_07548Help
Entry
SNOG_07548        CDS       T01161                                 

Definition
Mls1
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pno  Phaeosphaeria nodorum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SNOG_07548
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SNOG_07548
   00630 Glyoxylate and dicarboxylate metabolism
    SNOG_07548
Enzymes [BR:pno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SNOG_07548
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 543 aa AA seqDB search
MAANPDTILREVNILGELNDQNRHILSKDAAVFLALLHRTFNERRKALLQRRVIRQAELD
KGNLLDFLPETKHIRENATWRGAPPAPGLVDRRVEITGPTDRKMVVNALNSNVWTYMADF
EDSSAPTWDNMINGQLNLHDAIRRQVDFKQGEKEYKLRTDRTLPTLIARARGWHLEEKHF
TVDGEPISGGLFDFGLYFFNNAHELVKRGAGPYFYLPKMESHLEARLWNDVFNLAQDYIG
MKRGTIRGTVLIETITAAFEMDEIIYELRDHSSGLNCGRWDYIFSTIKRFRQNPQLVLPD
RDSVTMTSPFMDAYVKLLIKTCHKRGVHAMGGMAAQIPIKNDQQANDAAMAKVRADKLRE
VRAGHDGTWVAHPALAAIASEIFNEHMPTPNQMHVRREDVHITANDLLNMNVPGKVTEEG
IRKNLDIGLSYMEAWIRGVGCVPINYLMEDAATAEVSRSQLWQWTRHSVETAEGKKVTKD
YALKLLHEQAKALSQKAPKGNKFHVAEKYFAGQVTGEDYAEFLTSLLYNEITNVGPPKGA
SKL
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaaccccgacaccatcctgcgcgaggtcaacatcctcggcgagctgaacgac
cagaaccgtcacattctcagcaaagatgctgccgtcttccttgccctcctccaccgcaca
ttcaacgagcgccggaaagctctcctccagcgacgagtgatccgtcaagccgagctcgac
aagggcaacctgctcgacttcctccccgagaccaagcacatccgcgagaacgccacatgg
agaggtgcaccaccagcgcccggcctggtcgacaggcgcgtcgagatcaccggcccaacc
gaccgcaagatggtcgtcaacgccctgaactcaaacgtctggacatacatggccgacttt
gaggactcaagcgcgccgacgtgggacaacatgatcaacggccagctcaacctccacgat
gccatccgcaggcaagtcgacttcaagcagggcgagaaggagtacaagctccgcaccgac
cgaacactccctacactcattgctcgtgcccgaggctggcatctcgaggagaagcacttc
accgttgacggcgagcccatctccggcggtctcttcgatttcggactgtacttcttcaac
aacgcccacgagcttgtcaagcgcggagctggcccgtacttctacctgcccaagatggag
tcgcatcttgaggcaaggctgtggaacgacgtcttcaacttggcgcaggactacatcggc
atgaagcgcggcaccatccgaggcactgtcctgatcgagaccattaccgctgctttcgag
atggatgagatcatctacgagcttcgcgaccactcttctggtctcaactgcggtcgctgg
gactacatcttcagcaccatcaagcgcttccgccagaacccccaactcgttctgcccgac
cgagactccgtcaccatgacgagccccttcatggatgcatacgtcaagctgctcatcaag
acctgccacaagcgaggtgtgcacgctatgggcggcatggctgctcagatccccatcaag
aacgatcagcaggcgaacgacgccgccatggccaaggtccgtgccgacaagctccgtgag
gtgcgcgctggtcacgacggcacctgggtggctcacccagcgctcgctgccatcgcttcc
gagatcttcaacgagcacatgcctacacctaaccaaatgcacgtgcgccgtgaggatgtc
cacatcaccgcaaacgacctgctcaacatgaacgtgccaggcaaggtcaccgaggagggc
atccgcaagaacctcgacatcggtcttagctacatggaggcctggatccgcggtgttggt
tgcgtaccaatcaactacctcatggaggatgcggctaccgccgaagtgtcgaggagccag
ctgtggcaatggacaaggcatagcgtggaaactgctgagggcaagaaggtcaccaaggac
tacgccctcaagctgcttcacgagcaggctaaggcattgagccagaaggcacccaagggt
aacaagttccacgttgccgagaagtacttcgcaggccaggtcactggcgaggactacgct
gagttccttacctcattactctacaacgaaatcaccaatgtaggtccccccaagggagct
tcgaagctctaa

DBGET integrated database retrieval system