KEGG   Phaeosphaeria nodorum: SNOG_08115Help
Entry
SNOG_08115        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
pno  Phaeosphaeria nodorum
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:pno03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:pno03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 426 aa AA seqDB search
MAMLYMPSSFPAADLEAWFKPSARSERVQALDILERLHILGSKREDDKSLSYSLIPGFQR
SLRHAIEGSGTHRTFGVPASKAERGEKRLSIEFLDAHAREQWEGILFFMVSGAAGFQPGS
VKMDVGPGTKKLLHAGDLVRTVHGTPRITKEGFSFVLQETNAQVWNLLIVYLKMVDDLGM
SETEVLSFLFMLGSLELGQDYSTSTLSPSQLHMLDDLSAMGIVYRSSKDSPTFYPTRLAT
TLTSDSGALPGSDVGTTEKPDSKAQNKGFIIVETNYRLYAYTNSLIQIAILSLFTKLQHR
FPNLVSGKLTKESVHRAVQAGITSAQIISYLTTYAHPQMQKSNPPLPPTVMDQIRLWEYE
GERVEVTTGYLMREFGSESEYRDVMGYAQALGVLVWKNDANRCFFVSHVEQVAGYLKKKK
EGKGGR
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgctctacatgccctcgtcttttcccgccgccgatctcgaagcctggttcaag
ccctcggcgcgtagcgaacgtgtacaagcccttgatattctcgaacgcctgcatatcctc
ggttcgaaacgggaagacgataagagcttgtcgtactcgctcattccggggtttcagcgt
agcttgcgccatgccatcgaagggtcgggcacgcatcgcacgtttggtgtgccggcgtcg
aaggccgagagaggggagaagaggcttagtattgagtttctggatgcgcatgcaagagag
cagtgggagggcatattgttcttcatggtcagcggagctgcagggttccagccagggagc
gtgaagatggacgtcgggcctgggacgaagaagctgttacatgcgggagatctggtcagg
acagtgcatgggacaccgagaatcactaaggagggattcagcttcgtgctgcaggagacg
aatgcccaggtgtggaatctgctgatagtatacctcaagatggtcgacgatctgggcatg
tcagagaccgaagtcctctccttcctcttcatgctcggctccctcgaactcggccaggac
tactctacttcgaccctctctcccagtcaactccacatgctcgacgacctctctgccatg
ggcatcgtctaccgcagctccaaagactcacccacattctaccccacccgcctcgctacc
accctgacatccgactccggcgccctccccggctcagacgtcggcaccacggagaagccc
gacagcaaggcccaaaacaagggcttcatcattgtcgagaccaactacagactctacgca
tacacaaacagtctgatccagattgccatcctcagcttgtttaccaaactccaacatcga
tttcctaacctcgtctccggcaagctcacaaaggaatccgtccatcgcgccgtccaagca
ggcatcacgtccgcgcaaatcatctcctacttaaccacctacgcccatccgcagatgcaa
aaatctaacccgcccttgccacctaccgtcatggaccagatccgcctgtgggagtacgaa
ggcgagcgtgtcgaagttaccacgggctatttgatgcgggagtttgggtcggagagcgag
tatagagatgtgatgggctatgcgcaggcattgggcgtgctggtgtggaagaatgatgcg
aatagatgcttttttgtcagtcatgtggagcaggtggcggggtacttgaagaagaaaaag
gagggcaagggagggaggtag

DBGET integrated database retrieval system