KEGG   Phaeosphaeria nodorum: SNOG_08246Help
Entry
SNOG_08246        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
pno  Phaeosphaeria nodorum
Brite
Protein kinases [BR:pno01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   SNOG_08246
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2305 aa AA seqDB search
MSQQASSSLDRIVLDLRSKKERTISAKWSKQRIAISGLVKSGNDSNERIGGIHALNALID
FRGDDAGQKTTRFASYLRAVMNGQDTTAMVVAAKALGRLAKPGGTLTAELVEAEVKGALE
WLQLERMENRRFAAVLILRELAKNSPTLMYQWIAQIFEVIWVALRDPKVLIRESAAEAIS
ACFEIISPRDSQMRQLWFGKVYDEILRGFAIGSNEAIHGSLLTMKELLDKSPMFMNEQKY
KETVETVLKYKDHRDALVRREVVLIIPILAGYSPTEFATKYLHQCMLHLQGLIRKDRDRD
KAFVAIGQIANAVGVAISPYLEGILGFIQEGLLQKARNKLVVNEAPIFQCLSMIAAAVGQ
ALTKSVERLLDPIFSCGLSDSLFQALVDMAHYVPPSRPMIQEKLLDLLSQILAGRHFLPL
GSPYQVSQPPQIWTRDHKDPQTIGPREAEIALALHTLGSFDFNGHVLNEFVRDVAIRYVE
ADNAEIRKRAALTCCQLFVKDPIVHQTSTHATKVVGDIIEKLLTVAVGDVDPDIRYEVLL
ALDARFDRHLGKADNVRTLFLALNDEVFVIREAAMSIIGRLTSVNPAYVFPSLRKVLLQL
LTEVNYANSPRSKEESAQLISSLVGAADSLIKPLVDPIVTVLLPKAKDPNPEVASTTLKA
IGDLATVGGEGMIKYIPELMPVILEFMQDMSSDSKRFSALRALGQLATNAGYVIEPYRDY
PELMNILMNIVKTEPEGELRRETVRLMGTLGALDPDEYQKIMEQSPDKHLIMEAQAVTDV
SLIMQGITPSNEEYYPTIVISTLMGLLKDPSLVQFHSAVVDAVMNIYATMGLKCVPFLNQ
VVPGFLQVIRSTPAGRSEGYFNQLSQLVKTVRQHIRPYLPSILATIKEYWSSSPQLQATI
LSLIEAIARSLEGEFKVYLADVLPLMLSVLDSDNTGKRLPSERVLHAFLIFGSSAEEYMH
LIIPVMVKMFDKPGQPMHIRRLAIETLGRLSKQVNVSEFAARIVHPLCRVLSGSDPTLKQ
TALETLCALIFQLGPDYVHFVPTVNKILITHKVPHENYGRIVSKLQKGEPLPQDLSPDER
YGEDDEDMNTAEISTKKLAVNQQHLKQAWEASSKTTKEDWIEWMRRFSVELLRESPQQAL
RACTPLGSVYNPIARILFNSAFVSCWTELYDQYQEELVRSIETALTSPNIPPEILQILLN
LAEFMEHDDKALPIDVRILGMYAGKCHAFAKALHYKELEFNAEQNSNAVEALISINNQLQ
QTDAAFGILRKAQHYNDVELKETWYEKLQRWDEALQAYQDRERREGDSFEITMGKMRCLH
ALGEWDLLSTLSKEKWANAGQEYRKAIAPLAATASWGLGKFADMDSYLNVMKEQSPDRAF
FASILNIHNNRFEIAIDEIAKARKGLDTELSSLLGESYQRAYLPMIRVQMLAELEEIMQY
KQKREQQGQASQLVITPHEGTDMWIKYTNLCRKNNRMNLANKALQKLLDIEGTGDGRVVE
YVREHGHKIPHPVAYATYKFMWADQNFKQEALDSMKDFTARLSDDLAMRARAAANPMMAQ
NGMNGMAGQFNNMNPFAATNGSNGMNGSSILNGSNMGVSPSELAEAHRLLAKCYLKQGDW
QQELQDGEWEHEFVHEILSAYAAATRYNQNWYKAWHAWALANFEVINSITSKADRETTDV
PSNMVHDHVVPAIHGFFKSIALSSSSSLQDTLRLLTLWFSHGGLSEVNRTISEGTKSVPI
DTWLEVIPQLLARINQPNPTVRQSIHQLLTEVGKAHPQALVFPLTVSMKSDVSRRQRSAK
ELMEAMREHSPKLVEQADLVSHELIRIAVLWHEQWHEGLEEASRLYFGDHNIDGMFATLA
PLHAMLDKGPETLREISFIQSFGRELQEARDWCNTFRTSGEIGDLNQAWDLYYQVFRKIA
RQLPSLMSLELQYVSPKLKDAHDLELAVPGTYVVGKTVIRIISFDPVATVIQSKQRPRKL
EMRGSDGKAHTHILKGHEDIRQDERVMQLFGLCNTLLANDVESRKRHLNIQRYAAVPLST
QSGLLGFVPNSDTLHVLIREYRDSRKILLNIEHRIMLQMAPDYDCLTLMQKVEVFGYALD
NTTGQDLYRVLWLKSKSSEAWLDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRVTGK
IVHIDFGDCFEVAMHREKYPERVPFRLTRMLTSYTTPSSPGASTIPPPPSSPLSPRSAAN
PSWATRTHPPSTPSAPCSRAATARVLRRQPTTSRPRKCRTRAPCRCSPASRRNSRAEMDD
QARSRMSSIRSRGSLVRRRIWRICR
NT seq 6918 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagcaggcctcgtcctcgctggaccgcatcgtcctcgacctacgctcgaaaaag
gagcgcacaatctccgccaagtggtcgaagcagcgcatcgcgatctccggcctcgtcaaa
tcgggcaacgactccaacgaacgcatcggcggcatccacgcgctcaatgccctcatcgac
tttcgcggcgacgatgcgggccaaaagacgacgcgctttgcgtcttacctccgggcggtg
atgaacggccaggacacgacagccatggtggtcgcagcaaaagcgttgggaagactagcg
aagcctggaggaacactgactgcagagctggtagaggcagaagtaaaaggcgcgctggaa
tggctgcagctcgagcgcatggagaaccgccgcttcgccgccgtgctcatcctgcgcgag
ctggcgaagaactcgcccacgctcatgtaccagtggatcgcgcagatcttcgaggtcatc
tgggtcgccctgcgcgatccgaaagtgctcatccgcgagtccgccgccgaagccattagc
gcttgtttcgaaatcatctctccgcgagactcgcagatgcgccagctgtggttcggcaaa
gtctacgacgagattctgcggggctttgcgattggcagcaatgaggcgatacatggctcg
ctgctcacgatgaaggagctgctggacaagagccccatgttcatgaacgagcagaagtac
aaagagacggtcgagacggtgctcaagtacaaggaccatagggacgcgctggtgcggaga
gaggtggtacttatcattcccatcctcgcgggttattcgcccacagagtttgcgacgaag
tacctgcaccagtgcatgttgcatctgcagggtctgattaggaaggaccgcgatcgggac
aaggcttttgttgcgatcgggcagattgcgaatgcggtcggcgtcgcaatatcaccgtac
ctggagggcatactaggatttatccaggagggtctgcttcagaaagcgcggaataagttg
gttgtcaacgaggcacccatcttccagtgcctgagcatgattgcggcggcagtgggccag
gctcttacaaagagcgtggaacggttactggaccccatcttctcctgcggattgagcgac
tctcttttccaggctcttgtcgatatggcgcactacgttcccccttctcggccgatgatt
caggagaagctgctcgatcttcttagtcagattctcgctgggcgacatttcctgcccctt
ggcagtccgtaccaggtctcacagccccctcagatatggacgcgagatcacaaagacccg
caaacgattggtccccgggaagcggagattgcacttgctctgcacacgctcggaagcttc
gatttcaacggacacgtcctgaatgagttcgttcgtgatgttgcgattcgttatgtcgag
gcagacaatgctgagattcgaaagcgggcagccttgacttgctgtcagctatttgtcaag
gatccgatagtgcatcagaccagcacgcatgctacaaaggtcgtcggcgatatcatcgag
aagctccttactgtagccgttggtgatgtcgatcctgacatccggtacgaggtgcttctg
gctctagatgctcgtttcgatcgccatctcggaaaggcagacaacgttcggacgctcttc
cttgcgctgaatgatgaagtcttcgtcattcgcgaggctgccatgtccattattggccgc
ctaacatcggtcaatcctgcatatgtcttcccctctttgcgaaaagtactgttgcagtta
ctgacagaagtcaactacgccaatagcccgaggagcaaggaagaaagtgcacagctgatt
agtagtcttgttggcgcagctgatagcctcatcaagcccctcgtcgacccgatcgtcact
gtactcctgccaaaggccaaagacccgaacccagaggtcgcttccacaactctgaaagcc
atcggtgacttggctacagttggtggcgaaggcatgatcaagtacattccagagctcatg
ccagtcatactggagttcatgcaagacatgagctccgactccaagcgcttctcggcgctg
agagcactcggtcagctagccacgaacgctggctatgtcatcgagccatacagagactac
ccagagctcatgaatatattgatgaacattgtcaagacagagcctgaaggcgaacttaga
agggaaaccgtcagactcatgggtacgctgggtgcactggatccagatgagtaccagaag
atcatggagcagtcgccggacaagcatctcatcatggaagcacaagcagtcactgatgtc
tcccttattatgcagggcattaccccttcaaacgaagagtactacccaacgatcgtcatc
agtacactgatgggtctgctcaaggatccatcattggttcagttccattccgcggttgtg
gacgctgttatgaacatctacgccaccatgggactcaagtgcgttccttttctcaaccag
gttgtacctggcttcttgcaggttattcgttctacgccagccggacgctcggaaggctac
ttcaaccagctcagtcaactggtcaaaactgttcgccaacacatccgtccttacttgccc
agcatacttgccacgatcaaggagtattggagtagcagcccgcagcttcaagctaccatc
ctctcgcttattgaggcgattgctcggtcactcgagggggagttcaaggtatacctggcg
gatgtactgccgctcatgcttagtgtgctcgattcggacaacactggtaagcgacttcct
tctgagcgagtactacacgcttttcttatctttggatcgagcgcggaggaatacatgcat
ctcattattccggttatggtcaagatgttcgataagcctggacaacctatgcacatacgg
agattagcgattgagacgctgggacggttgtcaaagcaggtgaatgtttcggagttcgct
gcacggatcgtgcatcctctatgccgagtactgtctggttccgatccaacgctgaagcag
acggcgcttgagacgctctgtgcgctcatcttccagctcggaccggattatgtccacttt
gtcccgaccgtcaacaagatcctcatcactcacaaggttccacacgagaactatggtcgc
attgtgtcgaagctacagaaaggtgaaccactcccacaggacctgagcccagatgagcga
tatggagaggacgacgaagatatgaacacagcagaaatttcgaccaagaagctggcggtc
aatcaacagcatctcaagcaagcttgggaggcatcatcgaagacaacgaaagaggactgg
attgagtggatgcgaagattcagtgtggagcttcttagagagtcgccgcagcaagcactg
cgcgcttgcacaccgcttggcagtgtctacaaccctatcgcaaggatactgttcaactcg
gcctttgtctcatgttggacggagctctacgatcagtatcaggaagaacttgtgcgatcc
attgagacagctcttacatcgcctaacattccgccggagatcttacagattctcttgaac
ttggccgagttcatggagcacgacgacaaagcacttcccatcgacgtgcggatactcgga
atgtatgctggaaagtgtcatgcgtttgcgaaggcactgcattacaaggagctcgagttc
aacgcggagcaaaactctaacgctgtcgaagcgctcatcagtatcaataaccaactgcag
caaacagatgcagctttcggtatcttgcgtaaggcacagcattacaacgatgttgagctg
aaggagacatggtacgagaagctacaaaggtgggacgaggccttacaggcctaccaagat
cgtgaacgaagagaaggagattcgttcgaaatcaccatgggcaagatgcgatgtttgcat
gcccttggtgaatgggatctcctgtccacgctgtcaaaggagaagtgggccaatgcaggt
caggaatatcggaaggcaatagcaccacttgctgcaacggcgtcttggggtctaggcaag
ttcgccgacatggactcttacctcaacgtcatgaaggagcagtcgccagaccgcgctttc
ttcgcttctatcctcaacattcacaacaaccgcttcgaaattgccattgacgagatcgcc
aaggcgcggaagggtctcgatacagagctcagctcgctgcttggagaatcgtaccagcgc
gcttatctgcccatgattcgtgtgcagatgttagcggagcttgaggagattatgcagtac
aagcaaaaacgagaacaacaaggacaagcaagccagctggtcattacaccacatgaaggt
accgacatgtggatcaagtacaccaacctgtgccggaaaaacaacaggatgaacctcgcg
aacaaagccctccagaagctgctcgatatcgagggtacgggcgatggtagagtggtggag
tacgtccgcgaacacggccacaagatcccccatccagtggcgtacgcgacgtacaagttc
atgtgggcagaccagaacttcaagcaagaagcacttgattcgatgaaagactttacagcc
cgactttccgacgatcttgccatgcgagcaagagctgctgcgaacccgatgatggcgcaa
aacggcatgaacggtatggcaggtcagttcaacaacatgaatcccttcgcggcgacgaat
ggatccaacggcatgaacggctcaagcatcctcaatggttcaaacatgggtgtgtcgcca
tcagagctagccgaagctcatcgactgcttgcgaagtgctacctcaaacagggtgactgg
cagcaggagcttcaagatggcgagtgggagcacgaatttgtccacgagattctgtccgcc
tacgcagctgcgacacgatacaaccagaactggtacaaggcgtggcacgcttgggcactt
gccaacttcgaagtcatcaactcgatcacgtccaaggccgaccgcgagactacagatgtg
ccctctaacatggtgcacgatcatgtagttccggctatccacggcttcttcaagtctatt
gctctttcgtcgagcagttcacttcaggatacgctgcgcctgcttacgctgtggttcagc
catggtggtctgtctgaagtcaatcgtacgatttcagagggtaccaagtcggtgcccatc
gatacatggctggaggtcattcctcagctgcttgctcgtatcaaccaacccaatcccacg
gtcaggcagtcgatccaccaattgcttactgaagtcggcaaggcgcatccacaggctttg
gtgttcccattgaccgtctcaatgaagtcagatgtctcgcggagacagcgttctgccaag
gagctcatggaggccatgcgcgaacactcaccgaaattggtcgaacaggcagatctcgtc
agtcacgagctcatccggatcgcagtgctctggcacgagcagtggcatgagggtctcgag
gaggcaagtcgactttactttggcgaccacaatatcgatggcatgtttgcaacgctcgcg
ccacttcatgccatgctcgacaagggccctgagacgctacgcgagatttcgttcattcag
tccttcggccgtgagctgcaagaagccagggattggtgcaatactttccgcacttctggc
gagattggcgatctcaatcaggcttgggatctctactaccaggtcttcaggaagattgcg
agacaattgccttccctcatgtcacttgagctgcaatacgtctcgcccaagctcaaggat
gcgcatgatcttgagcttgccgtgcctggaacgtatgtcgttggtaagacagttatccgg
attatttcgtttgatcctgtcgccacagtcattcagtccaagcaaagacccaggaagctg
gaaatgcgtggtagtgatggtaaagcgcatacccatattctcaagggtcacgaggatatc
cgacaagacgaacgtgtcatgcaactctttggcctatgcaataccctcctcgccaacgac
gtcgagtctcggaagcgccacctcaacattcagcgttatgcggctgttccgcttagcacg
cagtccggtctgcttggattcgtccctaacagtgacacgctccacgtacttatacgagag
taccgtgatagtcggaagattctactcaacatcgagcaccgcatcatgctacagatggcg
cctgactacgactgtctcacactcatgcaaaaggttgaagtctttggctacgcgctggac
aacaccaccggccaagatctctaccgcgtgctctggctcaagtccaaatcttctgaagcc
tggctcgatcgtcgtaccaactacacacgctcgcttgccgtcatgtccatggtcgggtac
attcttggtctgggcgatcgccacccgtccaatctcatgctcgaccgcgtgaccggaaag
attgtgcacattgatttcggtgactgtttcgaagtcgccatgcaccgcgagaaatacccc
gagcgtgtacctttccgcctcacccgcatgttgacttcatacacgaccccctcctcacct
ggcgcctccaccataccgcctcccccgtcgagccctctttcccctcggagcgccgccaat
ccatcatgggcgacgcgcacgcatcctccgtcgaccccatcggctccatgcagccgcgcc
gccaccgctcgagtattgcgccgccaaccaacgacgtcgaggccaaggaagtgcagaacg
cgcgcgccctgcaggtgctctcccgcgtcaaggagaaactcacgggcagagatggacgac
caggcgaggagcagaatgtcatcgatcaggtctcgaggctcattagtgaggcgacgaatt
tggagaatttgtcgttag

DBGET integrated database retrieval system