KEGG   Parastagonospora nodorum: SNOG_08506Help
Entry
SNOG_08506        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K11541  carbamoyl-phosphate synthase / aspartate carbamoyltransferase [EC:6.3.5.5 2.1.3.2]
Organism
pno  Parastagonospora nodorum
Pathway
pno00240  Pyrimidine metabolism
pno00250  Alanine, aspartate and glutamate metabolism
pno01100  Metabolic pathways
Module
pno_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SNOG_08506
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SNOG_08506
Enzymes [BR:pno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     SNOG_08506
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     SNOG_08506
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CPSase_L_D2 GATase OTCace_N CPSase_sm_chain CPSase_L_D3 OTCace MGS Dala_Dala_lig_C ATP-grasp ATPgrasp_Ter ATP-grasp_3 Peptidase_C26 DJ-1_PfpI
Motif
Other DBs
NCBI-GeneID: 5975716
NCBI-ProteinID: XP_001798817
UniProt: Q0UIA8
Position
Unknown
AA seq 1840 aa AA seqDB search
MAPRADESQNMALELQDGHVCFGQSFGADKSIAGELVFQTGMVGYPESVTDPSYRGQILV
ITFPLVGNYGVPSREEMDSLLKDVPAHFESKEIHIAGLVVATYAGEEYSHHLATSSLGAW
LKEQGVPAITGVDTRALTKRIREEGSMLGRLLQRTSAAPSSTALTNGAVDTAALVDGEVE
DWKASFEQLEWSDPNAKNLVAEVSIEEPKLWSPDPSTALKHPSGRPVRVVTVDVGLKYNQ
LRCLVRRGVEVLQVPWDYDFPQLAGKEYDGLFISNGPGNPAMMESTVKHIKAAMDEARTP
IFGICLGHQLLARAAGADTLKMKFGNRGANIPCTSLLTGKCHITSQNHGYAVDSKTLPHG
WEELFVNANDGSNEGIRHVSRPYFSVQFHPEHTPGPRDTEYLFDVFISTIQKNLESNEIM
SKPVEFPGGTFEENKKAAPRVDVKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYT
ILINPNIATIQTSKGLADKVYFLPVNADFVRKVIQKERPDGIYVTFGGQTALQVGIQLKD
EFEGLGVKVLGTPIDTIITTEDRELFARSMESIGEKCAKSASANNVEEAMRCVKDIGYPV
IVRAAYALGGLGSGFANNDAELLDLCNKAFAASPQVLIERSMKGWKEIEYEVVRDSRDNC
ITVCNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALN
PFSREYCIIEVNARLSRSSALASKATGYPLAFVAAKLGLNIPLNEISNSVTKVTCACFEP
SLDYVVVKIPRWDLKKFTRVSTLLGSSMKSVGEVMSIGRTFEEAIQKAIREVDPNNLGFN
ETAALMGIDQELQTPSDQRLFAIANAMKSGYTVDKIWEMTQIDKWFLSRLKGLSNFEKDM
SSYNTASITLPLMKRAKELGFSDRQLAKFWDTNELAVRRVRIDAGIFPVVKQIDTVAAEF
PAMTNYLYLTYNGTEHDVSFDDNGIMVLGSGVYRIGSSVEFDWCSVRAIRTLRENGYVDS
SIYNPETVSTDYDEADRLYFENISLETILDIYTLENSGGVVISVGGQSPNNIALPLHRMN
VKILGTSPEMIDTAENRYKFSRMLDRISVDQPAWKELTSIDEAREFCSKVSYPVLVRPSY
VLSGAAMNTVYSEHDLANYLNQAADVSKDHPVVITKYIENAKEIEMDAVARNGTMIGHFI
SEHVENAGVHSGDATLILPPQDLDEDTIRQIEDATRKIGQALNITGPYNIQFIAKDNEIK
VIECNVRASRSTPFVSKVMGVDLIEMATKAMAGLPLVPYPPVNIPPEYVGVKVPQFSFSR
LSGADPVLGVEMASTGEVACFGRTKYEAYIKGLIATGFRLPKKNILLSIGSFKDKLEMLP
SIERLHKMGYNLFATAGTADYLQEHGLPVKFLEVLPEGDYDEQKAEYSLTQHLANNLIDL
YINLPSSNRYRRPANYMSRGYRTRRMAVDYQTPLVTNVKNAKLLIEAIARHYDLEVSKVD
FQEFFPPLGEHEQSNMELARLNGSLSLTQLLAKSPFKRKHITSVKQFSRADLHLLFTIAQ
EMRLGAQRQGCLDILKGRVLCTVFCEPSTRTSASFDAAMKRLGGEVIVINESVSSTQKGE
SIADTIRTLACYGDAIVLRHPAEESIDIAAKFSGVPVINAGNGSREHPTQALLDIFTMRE
ELGTVNGLNITFVGDLKYGRTVHSLCELLSHYDVTVNLVSPDSLGMPEGVKDGLKSRGQL
NKISNELTADIVASSDVLYCTRVQKERFPDPASYEKVKDAFVIDNKVLKGAKTNMIVMHP
LPRNNEIHEEVDFDPRAAYFRQMQYGLYTRMALLAMVMAP
NT seq 5523 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctcgcgcagacgaaagccagaacatggctctcgagctccaagatggccatgtc
tgctttggacagagcttcggtgctgacaagagcattgctggagagttggtctttcaaact
ggtatggtgggctaccccgagtctgtcacagacccttcataccgtggccaaattctggtc
atcacattccctctagtgggcaactatggtgtgccctcgcgagaagagatggacagcctg
ctgaaggatgtcccggcgcacttcgagtccaaggagatccacatcgcaggtctcgtagtt
gcgacctacgcgggagaggaatactcgcaccacttggccacctcttcgctgggcgcatgg
ctgaaggagcaaggtgtacccgccatcactggtgtggatacgcgagcactgacgaagcgc
atccgagaggaaggtagcatgctcggcagactgctccaaagaacctcagcagcccccagc
tctactgcgctcaccaacggtgctgtcgacactgcggccctggttgacggtgaagtcgag
gactggaaagccagcttcgagcaactcgaatggtcagaccccaatgccaagaacctcgta
gctgaagtgtccatcgaagagcctaagctctggtccccagacccatccactgccctcaaa
cacccctccggccgcccagtacgcgttgtcacagtcgacgttggtctcaaatacaaccag
ctgagatgcttggtccggagaggtgtcgaagtcctgcaggtgccatgggactacgatttt
cctcagctcgctggcaaggagtatgatggactgttcatctcgaacggtcctggtaacccc
gccatgatggagagcacagtcaagcacatcaaggctgccatggatgaggccaggactccc
atattcggtatttgcttgggtcaccaacttcttgcaagagccgctggcgccgacacactc
aagatgaagttcggtaaccgtggcgcaaacattccttgcaccagtctgctcacaggaaag
tgtcacatcacctcgcagaatcacggttatgcagtggactcaaagacacttccccatggc
tgggaggagctcttcgtcaacgccaacgatggcagcaacgaaggtatccgccacgtaagc
aggccctacttcagtgtccaattccacccagagcacactccagggcctcgcgacaccgaa
tacctcttcgatgtcttcatcagcaccatccagaagaacttggagtcaaacgaaatcatg
tcaaagccagtcgagttcccgggcggcaccttcgaggagaacaagaaggccgcaccacga
gtggatgtgaagaaagtcctcgtgcttggcagtggaggtctgagtatcggccaggctgga
gagtttgactactctggtagccaggccatcaaggctctgaaggaagaaggcatttacact
attctgatcaaccccaatatcgccacaatccagacctccaagggtcttgccgacaaggtc
tacttcctccccgtaaacgccgactttgtacgcaaggtcatccagaaagagcgaccagat
ggcatctacgtcacattcggtggccagacggctcttcaagttggtatccagctcaaggac
gagtttgaaggccttggcgtcaaggtgctcggtaccccaatcgacacaattatcactaca
gaggaccgcgagctatttgcccgcagcatggagtccatcggcgagaagtgtgccaagtcg
gcatctgccaacaacgtcgaagaagccatgcgctgtgtcaaagacattggctacccagtt
atcgtccgagctgcatacgctcttggagggctcggaagtggtttcgccaacaacgacgca
gagctgctcgatctttgcaacaaggctttcgctgccagcccgcaagtgctcatcgagcgc
agtatgaagggatggaaagagatcgaatatgaagttgttcgtgactctcgcgacaactgt
atcaccgtatgtaacatggagaacttcgaccctctcggtattcatactggagactccatt
gttgtcgcgccatcgcaaactctttccgacgaagactacaacatgctacgcaccacagcc
gtcaacgtcatccgccaccttggtgtggtcggagaatgcaacatccaatacgctctgaac
ccattctcccgcgaatactgcatcatcgaggttaacgctcgtctgtcacgttcctcggct
ttggcctccaaggccactggttatcctcttgccttcgttgctgccaagcttggtctcaac
atcccgctgaacgagatctccaactcggtcaccaaggtgacctgcgcttgtttcgagcca
tcgctcgactacgttgttgtcaagatccccagatgggacttgaagaagttcactcgtgta
tcgacactgcttggatcgtctatgaagagtgtcggtgaagtcatgagtattggcagaacc
tttgaggaagcgatccagaaggccatccgagaggttgaccccaacaacctcggtttcaac
gagactgctgcgttgatgggaatcgatcaggagcttcagacaccatccgaccagcgtctg
tttgccatcgccaatgcgatgaagagcggttacacggtcgacaagatctgggaaatgacc
cagatcgacaagtggttccttagccgtctcaagggcctgagcaacttcgagaaggacatg
tcaagctacaacacagcaagcatcaccctgccgttgatgaagcgagcgaaggagcttggt
ttctctgaccgccaacttgccaagttctgggacaccaacgaactggctgtgcgtcgtgta
cgtatcgatgccggcatcttcccagttgttaaacaaatcgatactgtggctgccgagttc
cctgctatgaccaactacttgtacctcacgtacaacggcacggaacacgacgtgagcttc
gatgacaatggtatcatggttctgggctctggtgtgtaccgtattggttcgtccgtggag
ttcgactggtgctccgttcgtgctatccgcacgcttcgtgagaatgggtacgtcgattcc
agcatatacaatcctgagaccgtttcaacggactatgacgaagcggatcgcttgtatttc
gagaacatctcgctcgagactatcctggacatctacactctggagaactccggcggtgtt
gtcatctctgtaggcgggcagtctcccaacaacattgccctgccactccaccgcatgaat
gtcaagatcttgggtacatcacccgagatgattgacactgcagagaaccgctacaaattc
tcacgtatgctggaccgcatctcggttgaccaacctgcctggaaggagctcacaagcatc
gacgaggccagggagttctgcagcaaggtttcctacccagtcttggtgcgtccatcgtac
gtgctttctggagctgcgatgaacacagtgtactcggagcacgatttggcgaactacctg
aaccaggcagccgatgtttccaaggaccaccccgtagtcatcacgaagtacattgagaac
gccaaggagattgagatggatgctgttgcccgaaacggtaccatgatcggccacttcatc
tctgagcacgtagagaatgctggtgttcactcgggtgatgctaccctcatcctaccacct
caggacttggacgaagacaccatcagacagatcgaagacgctacgagaaagatcggacaa
gcacttaacataactggaccatacaatatccagttcatcgccaaagacaacgagatcaag
gtcattgaatgcaacgtccgcgcttcccgctccactcccttcgtctcgaaggtcatgggt
gttgatctcatcgagatggctacgaaagctatggccggcctgcctcttgtgccgtaccct
cctgtcaacatccctcccgagtatgtcggcgtcaaggtaccacagttctcgttctcccga
ctatctggcgcagatcctgtgcttggtgtggagatggcttcgactggagaggtagcctgc
tttggacgcacaaagtacgaggcctacatcaagggcctcattgccaccggctttaggctc
cctaagaagaacattcttctctccatcggttcattcaaggataagctggagatgctgcca
tccatcgagcgtctgcacaagatgggctacaatctttttgccacggctggtactgcagac
tacctccaggaacatggtcttcccgtcaagttcttagaggtacttccagaaggtgactac
gacgagcagaaagcagagtactccttgactcagcatttggcgaacaatctcatcgacctg
tacatcaacctgccatcgagcaaccgctaccgacgaccagccaactacatgtctcgagga
taccgcactcgccgtatggcggtcgactaccagacaccccttgtcaccaacgtcaagaac
gccaagctcttgatcgaggccattgcacgccactacgatcttgaggtctctaaagttgac
ttccaggagttcttcccgcctcttggagagcatgagcaatccaacatggagctagccagg
ctcaacggctcactgtccttgacgcaacttcttgcgaagtctccgttcaagaggaagcac
attacgtcagtgaagcagttctcccgtgctgaccttcacttgctcttcaccattgcccag
gagatgcgtctcggcgcacagaggcagggatgcctcgacatcctcaagggtcgcgtcttg
tgcactgtgttctgcgagccctctaccaggacttcagcttcctttgacgctgccatgaag
cgccttggcggtgaggtcatcgtcatcaacgagtcggtctcctccactcagaagggcgag
tctatcgccgataccatccgcactcttgcatgctacggtgatgccatcgttctccgtcac
ccggctgaggagtcgatcgacattgcagccaagttctcgggagttccagtcatcaacgct
ggtaatggtagccgcgagcacccaacacaggctctgctcgacatctttaccatgcgtgag
gagttgggtaccgtcaacggcttgaacatcaccttcgttggtgatctcaagtacggccgc
accgtgcactccctctgcgagttgctctcccattacgacgtcaccgtcaaccttgtatct
cctgactcgctcggcatgcccgaaggagtgaaggatgggctcaagtctcgcggccagctt
aacaagatctccaacgagctcaccgccgacatcgtcgcctcgtcggacgttctctactgc
acacgtgtgcagaaggagcgcttccccgaccccgcaagctacgagaaggtcaaggacgca
tttgtcattgacaacaaggttctcaagggagcaaagacgaatatgatcgtcatgcaccct
ctgccaaggaataatgagattcacgaggaggtggactttgaccccagggcagcatacttc
agacagatgcaatacggattgtacacccgcatggctttgctcgcgatggtcatggccccg
tag

DBGET integrated database retrieval system