KEGG   Phaeosphaeria nodorum: SNOG_08675Help
Entry
SNOG_08675        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pno  Phaeosphaeria nodorum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SNOG_08675
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SNOG_08675
  Lipid metabolism
   00071 Fatty acid degradation
    SNOG_08675
  Amino acid metabolism
   00350 Tyrosine metabolism
    SNOG_08675
Enzymes [BR:pno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SNOG_08675
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 352 aa AA seqDB search
MGSIPTEQWAQVIEKTGGPVDFKKIPVQKPASDEVLVNIKYSGVCHTDLHAVNGDWPLAT
KLPLVGGHEGAGIVVAKGELVNDIEIGDYAGVKWLNGSCLACDFCQQADEPLCPKPLLSG
YTVDGTFQQYCIAKAAHVARIPKHCDLAAIAPILCAGITVYKGLKESGAKPGQFVAIVGA
GGGLGSLACQYAKVMGLRTIAIDTGAEKQKMCTEQLGAESFVDFATSKNLVADVQKATPD
GLGPHAVILVAVNEKPFQQAAEYIRPRGTVICIGLPAGAYLKAPVFESVIKMIRIQGSYV
GNRKDSSEAIDFFARGLIKAPFKVVGLSELQMVYDKMHKGEIAGRYVLDTSK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgggttctattcctaccgagcaatgggcgcaggttatcgagaagactggcggccccgtc
gacttcaagaagattccagtacaaaagcctgcttcagatgaggttcttgtcaacatcaag
tactctggtgtctgccacactgatctccacgccgtaaacggtgactggccactggccacc
aaactccccctcgttggcggccacgaaggcgcgggcattgtcgtcgccaaaggcgaacta
gtcaacgacatcgaaatcggcgactacgccggcgtcaaatggctcaacggctcctgcctg
gcctgcgacttttgccaacaagctgacgagccactgtgtcccaagcccctcctctccggc
tatactgtcgacggcaccttccagcaatactgcatcgccaaagccgcgcacgtagcccgc
atccccaagcactgcgacctcgcagccatcgcgcccatcctttgcgccggtatcacggtg
tacaagggcctgaaggaatccggcgcgaagcccggccaattcgttgccatcgtcggtgcc
ggaggcggtctgggctcgttggcgtgccagtacgcaaaggtcatgggcctgcggacaatt
gccatcgacacgggcgcggagaagcagaagatgtgcacggagcaactgggcgccgagtcc
tttgtcgactttgcaacgagcaagaatcttgtcgccgatgtgcagaaagctacgccagac
ggtctgggcccccacgctgtcatcctcgtcgccgtcaacgagaagccgttccagcaggcg
gctgagtacatccgtccccgtggtaccgtcatttgcatcggtctgccggcgggcgcgtac
ctcaaggcgcccgtgttcgagtcggtcatcaagatgatccgcattcagggatcgtatgtt
ggtaatcgcaaggacagctccgaggcgattgacttcttcgcgaggggtctgatcaaggcg
ccgttcaaggttgttggcctctcggagctgcagatggtttacgacaagatgcacaaggga
gagatcgctggacgatatgtcttggacacgtccaagtag

DBGET integrated database retrieval system