KEGG   Phaeosphaeria nodorum: SNOG_09074Help
Entry
SNOG_09074        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
pno  Phaeosphaeria nodorum
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:pno00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    SNOG_09074
  Replication and repair
   03420 Nucleotide excision repair
    SNOG_09074
Transcription machinery [BR:pno03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     SNOG_09074
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 416 aa AA seqDB search
MKLSEDDLYRTSTQYRAWSFTKQQLAAQRLKTNLQATERVKANVARQRAQRAQQTETDSI
GSGVENGSGATTPLPDRGSDVKEVDCLTADEELAIVDEFCERALQLGAHCQFPIEVTATC
IQFLRRFYLFNSPMTYHGQNISRTAMFLASKVEGAMRPIDHFATNFKKTTAEQILAPEYV
IVQGLRFNFDVRHPFRALKGGHLELMEIAKGTYEGPNYLEEGMTSADLSARMLKLPGKKG
QPSNATMQDMEKRITEAYGLASHILKTAALLTDAYFLYTPAQIWLAAHLLADGPITTFFL
SVKLPASSPHLPKLTAVIQSCATLLSSHRTYIATVNPKADDSAHKARVKALIEKLKSCRD
PDKVDLVKLNQAQKRDAVNEENGGVEENKAKRRKVGREEYQKASDEFWGPELGKKE
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtcggaggatgacctgtaccgcacgtctactcagtacagggcctggtccttc
accaagcaacaactggcggcgcaacgcctgaaaaccaacctccaagccaccgaacgcgtc
aaagcaaatgtcgcgagacaacgcgcccagcgagcacaacagaccgagacggatagcata
ggctctggagtcgaaaatggcagtggcgctactaccccgcttcccgatcggggcagcgac
gtgaaggaggtcgactgcttgacggcggacgaggagttggcgatagtagacgagttctgc
gagagagcactgcagctcggagcgcattgccagttccccattgaagttacagcaacatgc
atccaattcctgcgccgcttctacctcttcaactcgcccatgacctaccacggccaaaac
atctcccgcaccgccatgttcctcgcctccaaagtcgaaggcgccatgcgccccattgac
cacttcgccacaaactttaagaagaccacggcggagcagatcctcgcgcccgaatacgtc
atcgtccagggcctgcgcttcaactttgatgtccgacacccgttccgcgcgctcaaaggc
gggcatctggaactcatggagatcgcaaaggggacatacgagggcccgaattatttggaa
gagggcatgacgagcgcagatttgagtgcgaggatgttaaagttgccggggaagaagggc
cagccgtcgaatgctacgatgcaggacatggaaaagcgcatcacggaagcatacggcctc
gcatcgcacatcttgaaaaccgcagcgctcctgaccgatgcgtacttcctctacacgccc
gcgcagatctggctcgccgcccacctcctcgccgatggccctattacaaccttcttcctc
agcgtaaaactccccgcttcatccccccacttgcccaaactcaccgccgtcatacaatct
tgcgccaccctcctctcctcccaccgcacttacattgcaaccgtcaaccccaaggccgac
gacagcgcgcacaaagcgcgcgtcaaggccctgattgagaagctgaagagttgccgggat
ccggacaaggtggatttggtcaagttgaaccaagcgcagaagagggatgcagtgaacgaa
gagaacggtggtgtcgaggagaacaaggcgaagaggaggaaagtgggcagagaggagtat
cagaaggcgagtgatgagttttgggggcccgagttggggaagaaggagtga

DBGET integrated database retrieval system