KEGG   Phaeosphaeria nodorum: SNOG_09577Help
Entry
SNOG_09577        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
pno  Phaeosphaeria nodorum
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:pno00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    SNOG_09577
Enzymes [BR:pno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     SNOG_09577
Protein kinases [BR:pno01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   SNOG_09577
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 405 aa AA seqDB search
MATTMKSLLHPMQHHRDKKEGSSPHHSGPLHDRNDSAMDRPREEEKRTLAQWEQQKGTLS
PDEIYKDPEQKVVGHSSKVLREEDFELIKTLGTGTFARVWLVRLKDAKAEDEDKVFALKI
LRKVDVIRLKQVEHVRNERNVLAKVAGHPFITTMVASFQSLESLYMVLDYCPGGEVFSYL
RRARRFNEPTSQFYAAEIVLILEFLHEREGVAYRDLKPENILIDAEGHLKLVDFGFAKKV
ENRETYTLCGTPEYLAPEVIRNTGHGTAVDWWAFGILVYEFLVGQPPFWDQNPMKIYEQI
VEGKVRFPSAMSSDARDLISGLCTVDTSKRLGNISGGASRVKSHPWFKNIDWDRLYNREV
NGPIVPHLRGPADTRNFDEYEPESSHRDAYTKELSDKWDESFRDF
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcgactaccatgaagagcctactacacccgatgcaacaccaccgggacaaaaaggag
ggctcgtcgccgcaccactcgggcccgctgcacgacaggaacgactcggccatggaccgc
ccgcgcgaggaggagaagcgcacgcttgcacagtgggaacagcagaagggcaccctcagt
ccggacgagatatacaaggatcccgagcagaaagtagtcggccactcgtccaaagtgctg
cgagaagaagactttgagctcataaagacgctcggcactggcacttttgcgcgcgtgtgg
ctcgtgcgactaaaagacgccaaagccgaggacgaggacaaggtctttgcgctgaagatc
ctgcgcaaggtggacgtcatccgactaaagcaagtcgagcacgtccggaacgagcgcaat
gtcctcgccaaagtcgccggacaccccttcataaccaccatggtcgctagctttcaatcg
ctcgaatcactgtacatggtgctcgactactgccccggtggagaagtcttcagctacctg
cgaagagcgcgacgcttcaacgagcccacctcacaattctacgctgccgaaatcgtgcta
atactagagttcctccacgaacgagaaggcgtcgcataccgggatctgaaacccgagaac
attctcatagacgccgaaggtcaccttaagctggtcgactttggtttcgcgaagaaggtg
gagaatcgggagacctacacactgtgcggcacacccgagtatctggcacccgaggtcata
agaaatacaggccacggaaccgcagtcgattggtgggcattcggcatcctagtctacgaa
ttcttggtcggccaaccacccttctgggaccagaaccccatgaagatctacgaacaaatc
gtagaaggcaaagtgcgcttcccctcggccatgtcctcggacgcgcgcgacctgatctcc
ggcctctgcaccgtcgacacctccaagcgcctcggtaacatcagcggcggcgccagccgc
gtcaagtcacatccgtggttcaagaacatcgactgggaccgcctgtacaaccgcgaagtc
aacgggcccattgtcccgcacctccgcggcccggccgacacgaggaatttcgacgagtat
gaaccggagagcagccatcgtgatgcatacaccaaggagctgagcgacaagtgggacgag
agttttagggatttctaa

DBGET integrated database retrieval system