KEGG   Phaeosphaeria nodorum: SNOG_09680Help
Entry
SNOG_09680        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pno  Phaeosphaeria nodorum
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SNOG_09680
Enzymes [BR:pno01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     SNOG_09680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 282 aa AA seqDB search
MAFSPQALLPYVVLFVAAVGGWKVYSSGSKKVLKPNEFQEFELEEKTVLSHNTAIYRFKL
PRKTDILGLPIGQHISLGATIEGQPKEVVRSYTPISSDEDKGHFDLLIKSYPTGNISKYV
ANLKVGEKMRVKGPKGAMVYTPNMVRHFGMISGGTGITPMLQVVKAIIRGRGQGDTTEVD
LIFANVNPEDILLKEDLDALAAKDPKFRVHYVLNNPPEGWTGGVGFVTADMIKEKLPAPA
SDVKILVCGPPPMVAAMKKATESLGYAKAKPVSKLEDQVFCF
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggcgttctcaccgcaagcattgttgccgtatgtcgtgcttttcgtcgcagctgttgga
ggatggaaggtctacagcagtggatccaagaaggtgctgaagcccaatgagttccaggag
tttgagctcgaggagaagactgtcctttcgcacaacaccgccatctaccgcttcaagctt
ccacgtaagaccgatatcctcggcctccccatcggtcagcacatctccctcggcgccacc
atcgaaggtcagcccaaagaagtcgttcgctcgtacacgcccatctcctccgatgaagac
aaaggccacttcgacctcctcatcaagtcgtaccccaccggaaacatctccaagtatgtc
gcgaacctcaaagtcggcgagaaaatgcgcgtcaagggccccaagggcgcaatggtctac
acacccaacatggtcaggcacttcggcatgatttcaggcggcaccggcatcactcccatg
ctgcaggtcgtcaaggctattatccggggccgcggccagggcgacactaccgaggtcgat
ctcatcttcgcaaacgtaaaccccgaggacattctgctcaaggaggatctcgatgcgctt
gcagcaaaggaccccaagttcagggtacactacgtgctcaacaaccctccagagggctgg
accggcggcgttggattcgtcactgcggatatgatcaaggagaagttgcctgcgcctgcc
agcgacgtcaagattctggtttgcggtcctcctcctatggttgctgcgatgaagaaggcg
actgagagcttgggctacgcaaaggctaagccagtcagcaagctcgaggaccaggtcttc
tgcttctaa

DBGET integrated database retrieval system