KEGG   Phaeosphaeria nodorum: SNOG_09704Help
Entry
SNOG_09704        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
pno  Phaeosphaeria nodorum
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:pno04120]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:pno04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:pno04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 681 aa AA seqDB search
MLGKLYAAYDNNQKAIDSFVAALKLNPFMWDAFTGLCDLGAAVRPHNIFKITPDMLASIS
HTTSNGATHSTAPQESTDSRNPFVSTPDADPFNPSSRQGADVGLHQGGANLFSRLNGKSQ
TNGGYQNMETPVANGQNYHDEDVMMGEVGGPVLNEQGPEAQNNQPPPRRARLNFNAAEDP
PKMRPITSRSRTKAIPETDQTDIPRPINQNGHKRTVSGHSTQHSQSSSNQAIDPTAAPPR
RSVRLLNSVTTGFRTGSSRMANGASKDPEAKDRSRELRKVKATGTKGKPGSTSTVGRVVS
GNRNPHFDVVDSAKPQSRPTSAAAFNAPPPRMAPPVDTAREQEALTWLLGLLLKIGSGYK
HLSKYDTKKALEMFGSITPAQRDTPWVLAHIGKAYYERDQYVEAEEVFQRIREKVPSYLE
HMEVYSNTLWQLKKEVPLGHLAHTLMDQDRLSPQAWCALGNAKSLDRQHDDAIQCFVRAS
QLDPKFAYAFTLQGHEHVANEEFDKAMIAFRGAISADIRHYNGWYGLGTVYERMGKFDVA
EKHYREATRINPNNPMVLVRIGIMLDRMKKTEAALMMFENALKADMYSKMARFRKAQVLL
KLNAPSQSVEECLILKDIAPEDPNVHFLLGRCYKRLHDRANAIKHLTIAMNLDPKSHGII
KEVLESIDQDDDGGWSSEDDH
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgctaggcaagctctacgcggcgtatgacaacaaccagaaggcgatcgatagtttcgtc
gctgcgctgaagctgaatcccttcatgtgggatgccttcaccggtctatgcgatctcggg
gctgcggtccgtccccacaacattttcaagattactcccgacatgctagcatcgatatcg
cacacgacatcgaacggagctacacattctaccgcaccacaagagagcaccgactcaaga
aatcccttcgtttcgactccggacgccgacccgttcaacccctcaagtcggcaaggagcc
gatgttggactgcaccaagggggcgcgaatctgttttcgcggctgaatggcaagagtcag
acaaacggtggatatcaaaacatggagacgccggtcgcgaatggtcagaactatcacgac
gaagatgtcatgatgggcgaagtgggaggcccggtcttgaacgagcaaggtccggaagcc
cagaacaaccagccaccaccacggagggcacgcttgaactttaacgcagcagaggatcca
ccgaagatgcgcccgatcacgtcgcgatctaggaccaaggcgattcctgagaccgaccag
acggatatccctaggcccatcaaccagaacggccataagaggactgtttctggccattcg
acacaacacagccagtcgtcgagtaaccaggccatagaccccacagctgccccaccacga
agaagtgtccgtttgctgaattccgtaacgacaggtttccgtacaggaagcagtcggatg
gcgaacggagcaagcaaggatccagaggcaaaggaccgtagtagagagctccgcaaggtg
aaggcaacgggcaccaaaggcaaacccggctcaacttcaactgtgggaagggttgtcagt
gggaaccgtaacccgcatttcgacgttgtcgactcagcaaaaccccagtcgcggcccaca
agtgccgctgcgttcaacgccccaccaccacgaatggcaccgccggttgatactgcgcgg
gagcaagaggcgttgacctggctgctaggtttgttactcaagatcgggtcaggctacaag
catttgagcaagtacgataccaagaaggcgttggagatgttcgggtcgatcaccccggca
cagcgtgacaccccctgggtgctagcacacattggaaaagcttactacgaacgggatcag
tatgtcgaggcagaggaagtcttccaaaggatacgagagaaggtaccatcgtacctggag
cacatggaagtttactcgaacacattgtggcaactgaagaaggaggtcccattaggtcat
ctcgcgcacaccctcatggaccaggatcgtctttcaccacaggcttggtgcgctctcgga
aacgccaagtcattagatcgacagcatgacgatgcgattcagtgtttcgttcgagcttct
cagcttgatccgaagttcgcctacgccttcacgctccaaggccacgaacacgtcgccaac
gaggagttcgataaggccatgatagcattcaggggtgccatcagcgctgacatccgtcac
tacaacggatggtatggcttgggcaccgtgtacgagcgcatgggcaaatttgacgtggct
gagaagcactaccgggaagcaacacgtatcaatccgaacaaccccatggttcttgtacgg
attggcataatgcttgaccgcatgaagaagaccgaggccgcattgatgatgtttgagaac
gctctcaaggcggatatgtactcaaagatggcccgcttccgcaaggcgcaagtgctgctt
aagctgaatgcgccaagtcagtcagtcgaggagtgtctgatcttgaaagacattgctcca
gaagaccccaacgtccatttcctgcttggacggtgctacaagaggctccatgatcgcgcc
aacgctatcaagcatctgaccatcgccatgaacctcgatcccaagtcacatggcatcatc
aaagaggttctggagagtattgaccaggacgatgacggcggttggagcagtgaagatgac
cactaa

DBGET integrated database retrieval system