KEGG   Phaeosphaeria nodorum: SNOG_09845Help
Entry
SNOG_09845        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pno  Phaeosphaeria nodorum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SNOG_09845
   00052 Galactose metabolism
    SNOG_09845
   00500 Starch and sucrose metabolism
    SNOG_09845
   00520 Amino sugar and nucleotide sugar metabolism
    SNOG_09845
Enzymes [BR:pno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SNOG_09845
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 561 aa AA seqDB search
MASRAIPSHLKPSSAAGKDEGGFNSQRHHGKSQSHVAFENTSTNVAASQMRNALNKLADT
VEDPAEKKVSLMPKHTPLYLMDSRRDSHELLAASDGYGKVHVRHANYFETEMDNFFALFR
RYLNDKAKGTAIDWNRIAPPKAEQVVNYDDLANSEAVEYLNKLAVVKLNGGLGTSMGCVG
PKSVIEVRDGMSFLDLSVRQIEYLNRTYDVNVPFVLMNSFNTDTDTASIIKKYEGHNIDI
LTFNQSRYPRILKDSLLPAPKNNASDIANWYPPGHGDVFESLYNTGMLDKLLERGIEIIF
LSNADNLGAVVDLRILQHMVDSKAEYIMELTDKTKADVKGGTIIDYEGSVRLLEIAQVPK
EHVNEFKSIKKFKYFNTNNIWMDVAAIKRVVEANELAMEIIPNGKSIPADKKGEADISVL
QLETAVGAAIKHFKNAHGVNVPRRRFLPVKTCSDLMLVKSDLYTLQHGQLVIDPNRFGPA
PLIKLGSDFKKVSSFQSRIPSIPKIVELDHLTITGPVNLGRGVTLKGTVIIVATEGSTID
IPPGSVLENVVVQGSLRLLEH
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggcctctcgcgcaatcccgtcgcacctcaagccttcctctgccgctggcaaggatgag
ggcggcttcaactcgcagcgccaccacggcaagtcgcagtcccacgtggccttcgagaac
acatccaccaacgttgcagcttcgcagatgcgaaatgccctcaacaagctcgccgacacg
gtcgaggaccccgccgagaagaaggtgagcctcatgcccaagcacaccccgctgtatctc
atggattctcggcgagactcgcatgagcttctcgccgccagtgacggatatggcaaagtg
cacgtacgtcacgcgaactacttcgagacggaaatggacaacttcttcgccctgttccga
cgataccttaacgacaaggccaagggcaccgccattgactggaaccgcatcgcgcccccg
aaggccgagcaggtcgtcaactacgatgacttggccaactccgaggccgtcgaataccta
aacaagttggccgtcgtcaagctcaacggtggtctcggtacctccatgggctgcgttggc
cccaagtcggtcatcgaggtccgcgatggcatgtctttcctcgatttgtcagtacgccag
attgagtacctcaaccgcacatacgatgtcaacgtgccgttcgtcctgatgaactcgttc
aacaccgacaccgacacggcaagcatcatcaagaagtacgagggacacaacatcgacatc
ctcaccttcaaccagtcgcgctacccacgtattctcaaggattcgctgctgcccgcgccc
aagaacaacgcctcagacattgccaactggtaccctccgggtcacggtgacgttttcgag
tcgctgtacaacactggcatgctcgacaagctccttgagcgtggcattgagattattttc
ttgtccaacgctgataacttgggtgctgtcgtcgatctccgtatcctccagcacatggtc
gactccaaggctgagtacattatggagctgaccgacaagaccaaggctgacgtcaagggt
ggtaccatcatcgactacgagggctccgtccgtctgcttgaaattgctcaggtccccaag
gagcacgtcaacgagttcaagtcgatcaagaagttcaagtacttcaacaccaacaacatc
tggatggacgtagctgctatcaagcgcgtcgtcgaggccaacgagcttgccatggagatc
attcccaatggcaagtccatccctgccgacaagaagggcgaggccgatatctctgttctg
cagctcgagacggctgttggtgccgctatcaagcacttcaagaatgcacacggtgtcaat
gtccccaggcggcgattcttgcccgtcaagacctgctcagatctcatgctcgtcaagtct
gacctctacaccctccagcacggccagctggtgattgatcccaaccgcttcggccctgcc
cccttgatcaagcttggcagcgatttcaagaaggtgtcgagcttccagtctcgcattcct
tccatccccaagattgtcgagcttgaccatcttaccattaccggaccggttaacctcggc
cgcggtgttacgctcaagggtactgtcatcattgttgcgaccgagggctcaacgatcgac
atccccccgggttccgttctggagaacgtggtcgtccagggttcgctgaggttgctcgag
cactaa

DBGET integrated database retrieval system