KEGG   Phaeosphaeria nodorum: SNOG_10117Help
Entry
SNOG_10117        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
pno  Phaeosphaeria nodorum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SNOG_10117
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SNOG_10117
Enzymes [BR:pno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SNOG_10117
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 294 aa AA seqDB search
MSANSITVIFSPYHVGLRDHRVGDGPNRIRAMGVIEELKKLGVTIHVVELPPVDDFEGEI
GRSFELLRRTSKVVSDVCANRSFPLVLSGNCMASAGVACGLGLKDLGWIYFDAHDDMDTP
STNMNGYLDAMGLSMLGGKSFHRLANTIPGYTPHKYDKMIYCGLRDIEDSQKETVREAGA
EVIWGEPGKHVDFASRLTEALSAKDYSPALVHLDLDVLDESIGKVNGYESPGGLQEDDLI
KCMDLVPQKATPKSLTVCSFNPNLGDGDKVATIGVKAIVAFVKSLLKSEALVRE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaaattctatcactgtcatcttttcaccctatcatgttggccttcgtgatcac
cgtgtcggtgacggcccgaaccgcattcgagcaatgggtgtcatcgaagaattgaaaaag
ctcggcgtaactatacacgttgttgagctgccaccggttgatgattttgaaggggagata
ggtcgcagctttgagttactccggcggacgtctaaggtggtgtcagatgtgtgcgccaat
cgttcctttcctcttgttttatcgggaaactgtatggcaagcgctggagttgcttgtggg
ctgggcctcaaggatcttggctggatctactttgatgcgcacgacgatatggacacacca
tcaacgaacatgaacggatacttggatgcgatgggcctgtcaatgctaggtgggaaaagc
ttccatcggttggcaaatactattcctggatacactccgcacaagtacgacaagatgatc
tactgcggccttcgcgatatcgaggatagtcagaaggagactgtgcgagaggctggagcg
gaggtcatctggggagaaccaggcaaacacgtggactttgcgagtaggctcacggaagct
ctgagtgcaaaggactattcgcccgctttggtccatcttgaccttgatgttttggatgaa
agcatcgggaaggtcaatggttatgagagcccaggaggtttgcaagaggatgacttgata
aagtgtatggatctcgtcccgcagaaagctaccccaaaatccctcacagtctgttcattc
aatcccaacttgggagatggcgataaagtcgctaccattggtgtaaaggccatcgtcgcc
tttgtcaagtcgctcctcaaatccgaggctttggttagggaatag

DBGET integrated database retrieval system