KEGG   Parastagonospora nodorum: SNOG_10173Help
Entry
SNOG_10173        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pno  Parastagonospora nodorum
Pathway
pno00010  Glycolysis / Gluconeogenesis
pno00071  Fatty acid degradation
pno00350  Tyrosine metabolism
pno01100  Metabolic pathways
pno01110  Biosynthesis of secondary metabolites
pno01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SNOG_10173
  Lipid metabolism
   00071 Fatty acid degradation
    SNOG_10173
  Amino acid metabolism
   00350 Tyrosine metabolism
    SNOG_10173
Enzymes [BR:pno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SNOG_10173
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 5977361
NCBI-ProteinID: XP_001800455
UniProt: Q0UDJ1
Position
Unknown
AA seq 397 aa AA seqDB search
MTKMALKSTATYNIELIRSDLRPDRKTRKASCYRIPNVNAKYEGSPQNDVGMEKAPRKHG
TPHPAEKAGVCRSDRNLLTNENQPSWFKEKFTLGHEGCGVVVGLGTDFPQESGFAINDIV
AMCPVPGCGSLECEECSNDVPQLCLTGHRSGIGSDGFFSEYCVVDVRALAHVPAGVTPSQ
AAVATDAVTTAYHAIHRRGQITERDVVFLFGLGGLGFNALQVIQAIGAKVLVSDVKQQNL
DEAARIGVKREDIVPVGKSIREWVQENGWAGKISVVADFVGMAQTFDDAQHIGQYARLMF
TLPILNQSSLVRQAGRIVCVGTLNHENTVHMKLAIRKRLDIIFSYGGQTKDLREALDLIA
KGVLNPMVTDGKLQDFPKVMRDLEAGKVQGRIALLFA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagatggccctaaagtcaactgccacgtataacatagaactcattcgaagtgat
ctgagaccagataggaaaacccgtaaagcaagttgctaccgcatcccaaatgtcaacgcc
aaatatgaaggcagtccccaaaatgatgtgggcatggagaaagcaccgcggaaacatgga
acccctcacccagcggaaaaagcaggtgtctgtcgttccgaccgtaacctgctgacaaac
gagaatcaaccatcgtggttcaaagagaagttcacccttggacatgaaggttgtggcgtc
gtcgtcggccttggaacagacttccctcaggagtccggtttcgctatcaacgacatcgtc
gcgatgtgcccggtgcccgggtgtggttctctcgaatgcgaggagtgcagtaacgacgtg
ccgcagttgtgcctcacggggcatcgcagcggaattgggagcgacggattcttctcagag
tactgcgtggtagatgtacgtgcccttgcgcatgtgcctgcgggtgtgacgccaagtcag
gccgctgtggcgacagatgcggtaactacagcctaccatgcgatacatagaagaggccaa
attactgaacgggatgtggtgtttctgttcggattgggcgggttgggattcaatgcgttg
caggtcatccaagcgattggcgcgaaggtgctggtcagtgacgttaagcaacaaaaccta
gatgaagcggcaagaattggtgtcaaaagggaggatatagtacctgtggggaaaagtata
agggagtgggtgcaggagaatggttgggcggggaagataagcgtggtagcggactttgtg
ggcatggcgcagacgttcgatgatgcgcagcatattggtcagtacgctcgcctcatgttc
acactaccaatactaaatcaatcatcattagtacgacaagctggccgaatagtgtgtgtt
ggaactttgaaccacgagaacacggttcatatgaagcttgcgatccgaaaacgattagac
ataatattctcatatggcggccagacaaaagatctccgagaagccctagatctcatcgca
aagggcgtattgaaccccatggtaactgatggaaagcttcaggacttccccaaggtgatg
agagatctggaagcgggaaaggttcaaggtcgaatagcgctactgtttgcgtga

DBGET integrated database retrieval system