KEGG   Phaeosphaeria nodorum: SNOG_10397Help
Entry
SNOG_10397        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pno  Phaeosphaeria nodorum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SNOG_10397
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SNOG_10397
Enzymes [BR:pno01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SNOG_10397
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 224 aa AA seqDB search
MIRAASTAPRRILATSLRIKHKHLTPPLTTRLCVAIVTPTTRTYTRLRRATYATMSSATS
FFDFKPADKKGQPYDLAKLNNKVVLVVNTASKCGFTPQFAGLEKLYKDLKAQYPDDFEIL
GFPCNQFGGQDPGSNDEIQSFCQVNYGVSFPVLGKVDVNGDKADPAFEWLKNEKPGLMGL
KRVKWNFEKFLIGRDGKVKGRWASTKKPEDLKADIEKEIKAGKA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgattcgagcagcgagcacagccccgcgacgcatccttgcgacgagtttgcgcatcaaa
cataaacacctgacaccacctctcactactcgactttgtgtagctattgtaactcccact
acgcgaacgtatacacggctgcgacgagcaacatacgcaaccatgtcttccgcaacttcc
ttcttcgactttaagcccgcggacaagaagggccaaccctacgacctggccaagctgaac
aacaaagtcgtcctcgtcgtcaacacagcctccaagtgcggcttcacaccgcaattcgcc
ggcctcgagaagctgtacaaggacctgaaggcgcaatacccggatgactttgagatactc
ggattcccttgcaaccagtttggcggacaggatcctggatcaaacgacgagatccaatcc
ttttgccaggtcaactacggcgtgtccttccccgtgctcggcaaagtggacgtcaacggc
gacaaggcagacccggcgtttgagtggctgaagaacgagaagcccgggctcatggggctc
aagcgcgtcaagtggaactttgaaaagttcttgattggccgcgatggaaaggtcaaggga
cggtgggctagcacgaagaagcccgaggatctgaaggcggatattgagaaggagatcaag
gcgggaaaggcttag

DBGET integrated database retrieval system