KEGG   Phaeosphaeria nodorum: SNOG_10397Help
Entry
SNOG_10397        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pno  Phaeosphaeria nodorum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pno00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:pno00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 224 aa AA seqDB search
MIRAASTAPRRILATSLRIKHKHLTPPLTTRLCVAIVTPTTRTYTRLRRATYATMSSATS
FFDFKPADKKGQPYDLAKLNNKVVLVVNTASKCGFTPQFAGLEKLYKDLKAQYPDDFEIL
GFPCNQFGGQDPGSNDEIQSFCQVNYGVSFPVLGKVDVNGDKADPAFEWLKNEKPGLMGL
KRVKWNFEKFLIGRDGKVKGRWASTKKPEDLKADIEKEIKAGKA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgattcgagcagcgagcacagccccgcgacgcatccttgcgacgagtttgcgcatcaaa
cataaacacctgacaccacctctcactactcgactttgtgtagctattgtaactcccact
acgcgaacgtatacacggctgcgacgagcaacatacgcaaccatgtcttccgcaacttcc
ttcttcgactttaagcccgcggacaagaagggccaaccctacgacctggccaagctgaac
aacaaagtcgtcctcgtcgtcaacacagcctccaagtgcggcttcacaccgcaattcgcc
ggcctcgagaagctgtacaaggacctgaaggcgcaatacccggatgactttgagatactc
ggattcccttgcaaccagtttggcggacaggatcctggatcaaacgacgagatccaatcc
ttttgccaggtcaactacggcgtgtccttccccgtgctcggcaaagtggacgtcaacggc
gacaaggcagacccggcgtttgagtggctgaagaacgagaagcccgggctcatggggctc
aagcgcgtcaagtggaactttgaaaagttcttgattggccgcgatggaaaggtcaaggga
cggtgggctagcacgaagaagcccgaggatctgaaggcggatattgagaaggagatcaag
gcgggaaaggcttag

DBGET integrated database retrieval system