KEGG   Phaeosphaeria nodorum: SNOG_10498Help
Entry
SNOG_10498        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
pno  Phaeosphaeria nodorum
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SNOG_10498
Enzymes [BR:pno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     SNOG_10498
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 469 aa AA seqDB search
MNGAVSAAQRHAGQDEHQPQRRTSAYGGGSRVGLEETFAATSNVPSFATTKKDTPPLNSP
TSFDISKSEKTGRRSKRRSVRRALSKLRRQCIRHTWLGPLILSVFVISLYLVYPYPSNPI
AACLFLSYPLDSQDPLIPADVRADPNGPVHYGKGARDFAFVGFYIIVLSFTREYCMQRLI
RPIAIYYGIKSRAKQSRFMEQAYTALYFGLYGPFGLWIMSRTPVWYFNPIGMYEGFPHRT
NEGVVKAYYLLQASYWAQQLIVLLLMLEKPRKDFSQLVAHHFITISLIWLSYRFHFTYMG
IAVYITHDISDFFLATSKCLNYIDAPFVGPYFFVFMCVWAYLRHYLNLKIIWSILTTFKT
VGPYELNWETQQYKCWLSQIITLTLMASLQAINLFWFFLICRIAVRFILYKTADDDRSEY
EPSEEETEARERELKEELNDTANAAQGVLAEATGTEKTELKKRNGAAKS
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaacggagccgtttccgccgctcagcgacacgctgggcaagacgagcaccaaccccag
cgacgaacatccgcgtacggaggaggcagtcgagtgggcttggaggagacattcgcggcg
acgtcgaacgtgccgtctttcgcgacgacgaagaaagacacgcccccgctgaacagcccg
acaagcttcgacatatcgaagtcagagaagacaggccgccgttcgaaacgccgctctgtc
cgccgcgccctctccaaactccgccgccaatgcatacggcacacatggctcggcccgctg
atcctcagcgtcttcgtcatctcgctatatctcgtatacccgtatccctcgaacccaatc
gccgcatgtctgttcctctcatacccgctcgatagccaggaccctcttattccagcagac
gtccgcgccgacccgaacggaccagtccactatggcaagggagcacgcgactttgcgttt
gtcgggttttacatcatcgtcttgagcttcacgcgcgagtactgcatgcagcgactcatc
cggccgattgcgatatactacggcatcaagagccgcgcgaagcagtcgcgtttcatggag
caggcatataccgcgctgtactttggtctctacgggccctttgggctgtggatcatgtcg
cgcacgcccgtgtggtacttcaaccccatcggcatgtacgagggcttcccgcaccgcacc
aacgagggcgtcgtcaaggcgtactacctgctccaagctagctactgggcgcagcagctc
atcgtcttgctgctgatgctggagaagccgcgcaaggactttagccagcttgttgcgcat
cacttcattacaatcagcttgatttggctgagctatcggtttcacttcacctacatggga
atcgccgtgtatatcacacacgacatttctgactttttcttggctacttccaaatgccta
aactacatcgacgccccctttgtcggcccctacttcttcgtcttcatgtgcgtctgggcg
tatctgcgccactacctcaatctcaaaatcatctggtcgatcctcaccaccttcaaaacc
gttggcccgtacgaactcaactgggaaacgcagcaatacaagtgctggctgtcacaaatc
attactctcaccctcatggctagtttgcaagctatcaaccttttctggttcttcttgatc
tgccgcatcgcggtgcgttttattctgtacaagacggcggacgacgatcgcagtgagtac
gagccgagtgaggaggagacggaggcacgggagagggagttgaaggaggaactcaacgat
acggcgaatgcggcgcagggtgtcttggcggaggctacgggtacggagaagacggaattg
aagaagaggaacggcgctgcgaagtcgtaa

DBGET integrated database retrieval system