KEGG   Phaeosphaeria nodorum: SNOG_10869Help
Entry
SNOG_10869        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pno  Phaeosphaeria nodorum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SNOG_10869
Enzymes [BR:pno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SNOG_10869
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 326 aa AA seqDB search
MSSKPAVISVIGSLNVDLVTRTPRVPVAGETLTSESFNIGWGGKGANQAVACARLSRTQQ
QASSSAASDVEVRMVGAVGDDEFHLGFLKALQADGLKTDSIQIMKGKKTGVAVITVETTT
GENRIMFCPGANYDVEEKDLVDADASVALFQLELPLKVVLHNMKIARQKGVETIINPAPA
IPLPEEAYQGLGHLIVNETEAAILSGIENPTNWNEVAAVFIARGVKNVIITLGGEGVFYK
TSKQQSASQDGHIVPARKVKVVDTTAAGDTFAGAYTVSVARWKSMSQGADFDLDVVIAHA
NRAASMTVQKAGAQSSIPWADEVPET
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccaaacccgctgtcatttccgttattggttctctcaatgttgacctcgttaca
cgtactccacgagtacctgtggccggtgagaccttgacaagtgaatctttcaacatcggc
tggggaggaaaaggcgcgaaccaggccgtcgcgtgtgcacgcctctctcgcactcaacag
caagcatcgtctagtgcggcttccgatgtcgaagtgcgcatggttggcgctgttggagac
gatgaattccatttgggctttttgaaggcattgcaagccgatggcctaaagacggacagc
atccagattatgaagggcaagaagacaggtgttgcagtcattacagtcgagactaccaca
ggagagaacaggatcatgttctgtccgggcgcaaattatgatgtcgaagagaaggacttg
gtcgatgcggacgcaagtgtggctctctttcagctcgagctaccactgaaagtcgtattg
cacaacatgaagatcgcacggcaaaagggcgttgagacaatcatcaacccggcaccagcg
atcccactgcccgaagaagcctatcagggcttgggccatctcattgtcaacgagacagag
gccgccatcctttcaggcatcgaaaatccaacaaattggaacgaggttgccgctgtcttc
atcgctcgaggtgtcaagaatgtcatcattaccctaggcggcgaaggcgtcttctacaag
acttcgaagcaacaatcggcctcgcaggatggccacatagtaccggcgcgcaaggtcaaa
gtagtcgatacgactgccgcaggcgacactttcgcaggagcatacactgtctcagtagca
cgatggaaatcaatgtcccagggcgctgactttgatctcgatgtagttatagcgcatgcc
aatcgcgctgcctcaatgaccgtacaaaaggcgggcgcgcaatcctctataccttgggca
gacgaagtaccagaaacctag

DBGET integrated database retrieval system