KEGG   Phaeosphaeria nodorum: SNOG_11056Help
Entry
SNOG_11056        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
pno  Phaeosphaeria nodorum
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:pno00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SNOG_11056
Translation factors [BR:pno03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    SNOG_11056
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 343 aa AA seqDB search
MQSEAPRPFAAQDARLGEATRAGKRFGGDSSHGGRNPFNGVSPLTPGGLASPTTGGSSAF
GLGSGAFASFGSAAKTPKTPGTAFDFKTTAASTTSTSRPTTPADKKERPPGKIFNSARKE
SISTSIPEDTMSSSGELDPKAPWPLKCTWVVWFRPPTPKSSDYEKSIQPVFKFSTAQEFW
KVFSHLKRPSSLPTVSDYNVFKQGIRPVWEDEENKRGGKWIMRLKKGVADRYWEWLLMAI
VGDQFLEAGEEVCGIVLSVRSGEDVFSIWTKNDGGRNIKIRETVKRVLNLPDGTQIVWRS
HDDSIAQRTAIDQARHEKNHQGHEKRRVTSTDESQRDKALGGS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcagtccgaggcgccaagaccttttgccgcgcaagacgcgcgcttgggcgaagccact
cgggcagggaagcgatttggtggcgactcgtcgcatggtggcaggaatcctttcaacggt
gtctccccactgacgcccggcggtcttgcctctccaacaaccggaggctcctcggcgttt
ggccttgggtctggtgcgtttgcatcctttggctctgcggccaagacaccaaagacccca
ggcacggcctttgatttcaagacgaccgccgcaagcaccacttctacctccagaccaaca
acacccgcggacaagaaggaaaggccgcctgggaagattttcaacagcgcacgaaaggag
tcaatatccacatcgatacccgaagacacaatgagctcgtccggagagcttgatccgaag
gcgccttggcccctcaagtgcacctgggtagtatggttccgccctcctacacccaagagc
agcgattacgaaaagtcgatacaacctgtgttcaaatttagcacagcgcaagagttttgg
aaagtcttctcgcacctcaagcggccgtctagtctccctactgtcagcgactacaacgta
tttaaacagggaatacggccagtctgggaggacgaagagaacaaacgaggaggaaagtgg
attatgcgcctcaagaagggagtcgcggaccgctactgggagtggctgctcatggctatt
gtcggtgaccagttcttggaggctggagaggaggtctgcggcatcgtattgagtgtacgg
agcggcgaagacgtcttcagcatctggaccaagaacgacggcggacgcaatatcaagatt
cgggaaaccgtcaagcgcgttctaaacttgccggatggtacgcaaatcgtctggcgaagt
cacgacgacagcatcgcgcagagaacagcaatagaccaagcgcgccatgagaaaaaccac
cagggccacgaaaagcggagagtaacctcgacagacgagtcgcagcgggacaaggcgttg
ggagggtcatag

DBGET integrated database retrieval system