KEGG   Phaeosphaeria nodorum: SNOG_11093Help
Entry
SNOG_11093        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pno  Phaeosphaeria nodorum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SNOG_11093
Enzymes [BR:pno01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     SNOG_11093
Peptidases [BR:pno01002]
 Cysteine Peptidases
  Family C44
   SNOG_11093
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 610 aa AA seqDB search
MGELPFHDPEGDVHAVVNGELYGYNEVREQLSAKGYKFRSKCDSEIAIFLYKEYGVSFLS
HLRGEFSLCLYDSKAQIFFAACDRYAIKPLYYTVHEGNLLAFLPFGWQAEWDVQSIKDVG
WLCDRRTLFKDVKSINPGHYLILTSFSTVSQHKYWDLDFKDKVKRPPLYHREVETRTEDE
MIQGVRDRLFEAIRDRLRADVPIGVFLSGGIDSSAIAGMVTHLMKTEGTSLGTAPASEAI
NCFSVKFIGEEHDEEPIARRTAKWLGVKMHHVEMTEERFAANIEDAVWHNETAVKDLGTV
GKFMLSRLTRDAGIKVVLTGEGSDEHFGGYRELVKDFVREPDPSWPSSTLSEADRLRAIA
DLETATSSHPNEPNTAASVRRQVNNTSFLGFTQYFALDEPLLSPWTSTEFGTSDKRLTAV
HALDGLTRDCMNLKWHPLHTSLYIWTKCALAKGLLTVLGDRCEMAHSVEGRQPFLDHRLT
EYAMSLPPSMKIRFDPITGSFSEKWILKEAVKPYITQELYERKKHPFSAPVRYKEGGAVY
ELFERLITKENVEELGWLEWGRCEGLVERAIMEGDRSAFGQMILVGQFVILGKRFGVKKA
VPDWAGVGNE
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagttgccattccatgatccagaaggcgatgtgcacgccgtcgtcaacggcgag
ctatatggctataacgaggtccgagaacagctcagtgcaaagggctacaagtttcgcagc
aagtgcgattcggaaattgccatattcttgtataaagagtacggggtttcatttctctcg
catctccgtggagagttctcgctctgtctctatgactccaaagcacagattttcttcgca
gcgtgcgatcggtatgcgatcaaaccactgtactacacagttcatgaaggcaatctgctc
gcgtttcttcccttcggatggcaagcagaatgggatgtgcaaagcatcaaagatgttggc
tggctgtgcgatcgaagaacactgttcaaggacgtgaagtccatcaatcctggccactac
cttatcttgacctctttcagtacagtttctcagcacaagtactgggatcttgactttaaa
gacaaggtaaagcggccgcctctttaccaccgcgaagtggaaacacgcacggaggacgag
atgattcaaggtgtacgcgaccgactctttgaggcaatccgagatcgactacgcgcggac
gtaccgatcggtgtctttctcagcggtggcatcgattccagtgcgatagccggcatggta
acgcacctcatgaaaaccgaaggcacgtcgctaggcacagcaccagcatctgaagccatc
aactgtttcagcgtcaagttcatcggcgaagaacatgacgaagagcccatcgcgcgcaga
actgcaaagtggctaggcgtcaagatgcaccatgtcgaaatgactgaggaaaggttcgcc
gccaacattgaagacgcagtgtggcacaacgaaaccgcggtcaaagatctcggcactgtc
ggaaaattcatgctgtccagactcacccgcgacgccggtatcaaagtcgttctcacaggc
gaagggtctgatgaacactttggtggctaccgcgaactcgtgaaggacttcgttcgcgag
ccagatccttcatggccatcatccaccctctccgaagctgaccgcctgcgcgccatcgca
gacttggaaacagctacatcatcccatcccaacgagcccaacactgcagcttcagttcgc
cgtcaagtcaacaacacctccttcctcggcttcacgcaatacttcgcgctggacgaaccc
ctcctcagcccctggacatctactgaattcggcacgagcgacaagcgcctcaccgccgtc
cacgccctcgacggcctcacgcgcgactgcatgaatctcaaatggcacccgttgcacaca
tcgctgtacatatggaccaaatgcgcgcttgcaaaaggcctactaaccgtcctcggtgac
cgctgcgaaatggcacatagcgttgagggccgccagcctttcctcgaccatcgactgacc
gagtacgccatgtctctacctccttctatgaaaatccgcttcgatcccataaccggctcg
ttcagcgagaagtggatcctgaaagaagctgtgaagccatacatcacccaggaattgtat
gagaggaagaaacacccgttttcggcgccggtaaggtataaggaagggggcgcggtgtat
gagctttttgaacggctaattacaaaggagaatgttgaggagttggggtggttggagtgg
gggaggtgtgaggggttggtggagagggcgattatggagggggataggagtgcgtttggg
cagatgattcttgtgggacagtttgttattttggggaagaggtttggggttaagaaggcg
gtcccggattgggctggggtggggaatgagtag

DBGET integrated database retrieval system