KEGG   Phaeosphaeria nodorum: SNOG_11256Help
Entry
SNOG_11256        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pno  Phaeosphaeria nodorum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SNOG_11256
Enzymes [BR:pno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SNOG_11256
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 325 aa AA seqDB search
MDADTTKPGSAIPSHVNGEQTAQKVPTEVRDQKERENLYNAIDKSNRGRQPVDFEGTSGS
YFPVKTAAANMNGEAPQETHHVVNGEIDVEGYNQGSKTPLKTSRAHSPYTQHPTIDFDGL
SWPSKGTLARKEATEEEKKERLEKLSGAVRTMLECLGEDPDREGLRDTPDRYAKALLFFT
KGYEENLRDIVNGAVFHEDHDELVIVKDIEIFSLCEHHLVPFTGKMHIGYIPNRRVIGLS
KLARIAEMFSRRLQVQERLTKQVALALSEMLQPQGVAVVVESSHLCMVMRGVQKTGATTT
TSCMLGRMRSTAKTREEFLRLIDRR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggacgctgacacgacgaaacccggttctgccatcccctcccacgtaaatggcgagcag
acggctcaaaaggtccctaccgaagtacgcgatcagaaagagagggagaacctctacaat
gccatagacaaatccaaccgaggtcgccagccagtcgactttgagggaacgagcggcagc
tacttccccgtaaagactgctgcagccaacatgaacggagaagctcctcaggagactcac
catgtcgtcaatggcgagatcgacgtggaaggctacaaccagggcagcaagacgccactc
aagaccagccgcgcccacagcccatacacccagcaccccaccatcgacttcgacgggctc
agttggccgagcaagggcacactggcacgcaaagaggcaaccgaggaggagaagaaagag
cgtctcgagaagctgtcgggtgctgtcagaaccatgctcgagtgtctgggtgaggaccca
gaccgcgaaggtctccgagacacccccgaccgttacgccaaggcactgttgttcttcacc
aagggatacgaagagaacctacgagacattgtcaacggcgcagtgttccacgaggaccat
gacgagctggtcattgtaaaggacattgagattttctcactatgcgagcaccacctggtg
cccttcactggcaagatgcatatcggctacattcccaatcgccgcgtgatcggactctcc
aagctcgcccgcatcgctgaaatgttttctcgccgactccaagtccaagagcgcttgaca
aagcaggtcgcccttgccctctccgaaatgctgcagccccaaggtgtcgctgtcgttgtc
gagtcaagccatttgtgtatggtgatgcgcggcgtccagaaaaccggcgcgaccacaaca
acaagctgtatgctgggacgtatgcgatcgaccgccaagacgagagaggagtttctgcgc
ctcattgaccgacggtag

DBGET integrated database retrieval system