KEGG   Phaeosphaeria nodorum: SNOG_11449Help
Entry
SNOG_11449        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pno  Phaeosphaeria nodorum
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pno00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 336 aa AA seqDB search
MFARQVIRPARQLQQHVRRYASEAPQSGGSSNGALYVGIGAAGLAGAYIYMRGGKPAAPL
SEEANKVAAKVGGASKKAFTGGDQGFISLLLDKSEVVNHNTKKLTFKLPEPDMESGLPVT
SAVITKYKGPEMEKPVIRPYTPVSDVDQQGTVDFIVKKYEKGPMSSHMHNMEPGQRLDIK
GPIPKYPWSPNKHEHIALIAGGTGITPMWQTARAIFKNPEDKTKVTLVFGNISEEDILLK
KEWEHLENTYPQRFRAFYVLDNPPESWQGGKGFITKELLKTVLPEPKEGEKVKIFVCGPP
GMYKAISGGKKSPSDQGELDGYLKELGYSKDQVYKF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctagacaggtcattcgtccggcgcgacagctgcaacagcatgtccgccgatat
gcctctgaagcacctcagagcggcggcagcagcaatggcgctctctatgttggaattggt
gcagccggccttgctggtgcctacatctacatgaggggcggcaagccagcagcgccgcta
tcagaggaggcgaacaaggttgctgcgaaggttggcggcgcaagcaagaaggctttcact
ggtggcgaccagggctttatctcgctcttgttggataagtcggaggtagtcaaccacaac
accaagaagctcaccttcaagctgccggagcctgacatggagagcggtcttcccgttacc
tccgccgtcatcacgaagtacaagggcccagaaatggagaaacccgtcatccgaccgtac
acgcccgtcagcgacgtcgaccagcagggcaccgtggacttcatcgtcaagaagtacgag
aaagggcccatgtcgagccacatgcacaacatggagcctggccagcggctagacatcaag
ggaccaatccccaaatacccatggtccccaaacaaacacgaacacattgcactgatcgcc
ggaggaactggcatcacacccatgtggcagaccgcgcgcgccatcttcaagaaccccgag
gacaagaccaaggtcacactggttttcggcaacatctccgaggaggacatcctgctcaag
aaggaatgggagcacctcgagaacacctaccctcagcgattcagggccttctacgtcctc
gacaacccacctgagtcgtggcaaggtggcaagggcttcatcaccaaggagctgctcaag
actgtccttcctgagcccaaggagggcgagaaggtcaagatctttgtctgcggtcctcct
ggcatgtacaaggccatcagcggtggcaagaagagcccatcggaccagggcgagctggac
ggatacctgaaggagcttggatacagcaaggaccaggtctacaagttttag

DBGET integrated database retrieval system