KEGG   Phaeosphaeria nodorum: SNOG_11530Help
Entry
SNOG_11530        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
pno  Phaeosphaeria nodorum
Brite
Enzymes [BR:pno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     SNOG_11530
Transcription machinery [BR:pno03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     SNOG_11530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 446 aa AA seqDB search
MLSGKDMLRLRQTLGYKTSPPTSPSGPPAPLWHIEAPSHSPPSPTPSSPEVPLQELRANR
QDSPVKRKANDPLQVGSPKRAKQESPDSPSGVEDAPPEPKKRVVPFPENPAAIEEREGHI
EFRVVNNDGRRESTIILTGLKCIFQKQLPKMPKDYIARLVYDRTHLSIAIVKKPLEVVGG
ITYRPFDKGQFAEIVFCAVSSDQQVKGYGAHLMSHLKDYVKATSQVMHFLTYADNYAIGY
FKKQGFTKEITLEKSRWMGYIKDYEGGTIMQCSMVPKIRYLESRRMLLKQKESMPRPAQW
AKGEVKAIDPLTITAIKNSGWSPVMDELARAPRHGPNYNALLHLLNDMQNNSNAWPFQQP
VNKDEVLDYYDVIKEPMDLATMEEKHEKDLYPTPEEFIRDAKLIFDNCRKYNNESTPYAK
AANRLERYMWQRIREIPEWSVSFTDD
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcgggcaaagacatgctgcgtctgcgccagacgctgggctacaagacatctccc
ccaacttcacccagcggcccacccgcgccactctggcacatagaggctccttcacactca
cctccttcgccgactccttcgtccccagaagtacctctccaagagctgcgagctaaccgc
caggattcgccagttaagcgcaaagcgaacgaccctctccaggtcggctcccccaagcgc
gcaaagcaagagagccccgactcaccctctggcgttgaggatgccccgcccgaaccgaag
aagcgcgtagtccccttccccgagaacccggcggcaatcgaggagcgggaaggacacatc
gagttccgcgtcgtcaacaatgacggacggagagagagcacaatcattctcacgggcctg
aaatgcattttccaaaaacagctgcccaagatgcccaaggactatattgcgcggcttgtc
tacgaccggacgcatttgagcatagcaatcgtcaagaagccgctcgaggttgtgggtggc
atcacataccgccccttcgacaagggccaattcgccgaaatcgtcttctgcgccgtctcc
tcagaccaacaagtcaagggctacggcgcgcatctcatgtcccatctcaaagactacgtc
aaagccacctcacaagtcatgcacttcctcacctacgccgacaactacgccatcgggtac
tttaagaaacaaggcttcaccaaggaaatcaccctcgagaagtcgcgctggatgggctac
atcaaagactacgagggcggcacaatcatgcagtgcagcatggtgcccaagatccgctac
ctcgagtcccgccgcatgctcctgaaacaaaaggagtccatgccccgccccgcccaatgg
gcaaagggcgaagtcaaagccatcgaccccctcaccatcaccgccatcaagaactcaggc
tggtcccccgtcatggacgaactcgcccgcgccccgcgccacggaccaaactacaacgcc
ctgctccatctcctcaacgacatgcaaaacaacagcaatgcatggcccttccagcaaccc
gtcaacaaagacgaggtcctcgattactacgatgtgattaaagagcctatggaccttgct
accatggaagaaaaacacgaaaaggatttataccccacccccgaggagttcatacgcgat
gcgaagctcatctttgataattgccgcaagtacaataatgagagcactccgtatgccaag
gcggcgaatcgcctcgagaggtatatgtggcagcgcattagggagattcccgagtggtcg
gtgagttttacagatgactaa

DBGET integrated database retrieval system