KEGG   Phaeosphaeria nodorum: SNOG_11892Help
Entry
SNOG_11892        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
pno  Phaeosphaeria nodorum
Brite
Enzymes [BR:pno01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     SNOG_11892
    1.3.1.94  polyprenol reductase
     SNOG_11892
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 329 aa AA seqDB search
MGQTLIRIIGALRPHHFLVTVLCPPSASRSAHFSLITTMSRPAPPASSLEHPANTPAVLL
RVFYLAASLLILAIQLVPALRRRFLVYGSRTTPTGKSAPSEEPAQKTALDTLLDDFAAIQ
VPHNYFTHFYITSVISSLFWGLWLRVWTTPGQLQVVWMLMLLQGVRRLLESDAYTSKSKS
RMWFVHWLLGIAFYLAMNVSIWIEGAHQGPRHWSTTMLVPAVLTAHVFQHSFHAYLYRLR
SEKKGYQLPSHPIFTNLLCPHYTCEVLIYTFLSFLAAPDGRWVSWTMVCGTIFVASNLGV
TAWGTKEWYAEKFGQDKVGHRKRMVPWIW
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgggccaaactctaattcgcattattggcgcactccgcccgcatcatttcctcgtcact
gtgctgtgcccgccaagtgcctcgcgcagtgcacacttctctctcatcaccaccatgtca
cgcccagcaccgccagccagcagcctcgagcacccggcgaacacacccgccgtgctgctg
cgcgtcttctatctggctgcctctcttcttattctggccatccagcttgttcctgccctg
cgccgccgctttcttgtatacggctctcgtaccactccaacgggcaaaagcgccccgagc
gaggagcccgcgcagaagacggccctcgacacgctcctcgacgacttcgccgccatccag
gtcccccacaactacttcacccacttctacatcacctcggtcatctcctcgctcttctgg
ggcctatggctgcgcgtgtggaccacgcccggccagctgcaggtcgtgtggatgctcatg
ctgctgcagggcgtgcgcaggctgctcgagtccgacgcctacacgtccaaaagcaagagc
aggatgtggttcgtccattggctgctgggcattgctttttacctcgccatgaacgtctcc
atatggatcgagggcgcccatcagggtccgagacactggtccaccaccatgctcgtgcct
gccgtcctgactgcgcacgtgtttcagcacagcttccacgcctacctctatcgcttgcgc
agcgagaagaagggctaccagctgccatcacaccccatctttactaatctgctgtgtcca
cactacacgtgcgaagttctcatctacacatttctgtcgttcctcgctgcgcccgacggc
cgctgggtgagctggactatggtgtgcggcaccatcttcgtggcctcaaacctgggtgtg
accgcctggggtaccaaggagtggtatgccgagaagtttggccaggacaaggtaggtcac
cgcaagaggatggtgccatggatatggtag

DBGET integrated database retrieval system