KEGG   Parastagonospora nodorum: SNOG_11919Help
Entry
SNOG_11919        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K08294  mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
pno  Parastagonospora nodorum
Pathway
pno04011  MAPK signaling pathway - yeast
pno04139  Mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:pno00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    SNOG_11919
 Cellular Processes
  Transport and catabolism
   04139 Mitophagy - yeast
    SNOG_11919
Enzymes [BR:pno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     SNOG_11919
Protein kinases [BR:pno01001]
 Serine/threonine kinases: STE group
  STE7 family
   SNOG_11919
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like FTA2 APH YrbL-PhoP_reg Seadorna_VP7 Kdo
Motif
Other DBs
NCBI-GeneID: 5979062
NCBI-ProteinID: XP_001802154
UniProt: Q0U8J5
Position
Unknown
AA seq 480 aa AA seqDB search
MSQAVPLLRPPVPGGRSQGGGRTAPRLGLSIPASPNARPVTNGTNEVQPSLSRPMPPALR
LATPMGSNTTPQEGRRALPPLRIGTGSSAGGSSDASADSRSGSMGEMQANGSASSYQATL
GFPGLQTGTDPISAISQGGSEGAPSMERENSSQPLPDLDAMAADLGRPLEVDDLDEAGWK
AASGRGMIEELGSLGEGAGGAVTKSRLKGGKTTFALKIITTDPNPEVKKQIVRELSFNKN
CASEHICKYYGAFVDDSTGTISIAMEFCEGGSLDAVYREVKKLGGRTGEKVLGKVAEGVL
NGLTYLHSHRIIHRDIKPSNILLCRNGQVKLCDFGVSGEFGTKGDANTFIGTSYYMAPER
ITGQSYTITSDVWSLGVTLLEVAQHRFPFPADGTEMQPRAGLIDLLTYIVRQPIPKLKDE
PEAGIKWTENFKYFIECCLEKECPRRATPWRMLEHPWMVEMKSKKVNMAHFLKQVWDWQD
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaagcagtgcccctccttcgcccacccgtcccaggcggccgctcccagggcggt
ggccgcacagcaccgcgtctgggcctctccatcccggcctcgccaaatgcgaggccagta
accaacggcacaaatgaagtccagccgagcttatcgcggcccatgccgccagctctccgc
ctcgccacgcccatgggctccaacaccacaccacaagaaggccgacgagccctgccacca
ctgcgaatcggtaccgggtcgtcagcagggggttcgagtgatgcgagcgctgattcgagg
tcgggcagcatgggcgagatgcaggcaaatgggtcggcatcgtcatatcaggccacgcta
ggattcccaggtctgcagacgggtaccgatcccatctctgcgatatcacaaggaggaagc
gaaggtgccccgtcaatggagcgggagaacagcagccagccactgccagatctagacgcc
atggctgctgaccttggacggccgctggaagtcgacgatctagacgaggccggatggaaa
gccgcaagtggacgggggatgatagaagagctgggaagcctgggtgagggtgccggcggt
gctgtaacgaagagcagactcaagggcgggaagaccacttttgcgctcaagatcatcacc
acggaccccaaccccgaggtcaagaagcagatcgtacgagaactgtcattcaacaagaac
tgcgcgagcgaacacatctgcaaatactacggagcctttgtcgacgacagcactggtacc
attagcatcgccatggagttctgcgagggcggctcactcgacgccgtgtaccgcgaagtc
aagaaactgggcggtcgcaccggcgaaaaggttctcggcaaagtggccgagggcgtgctc
aatggtctcacatatctacattcccaccgcattattcaccgagacatcaagccaagcaac
attctcctttgccggaatggtcaagtcaagctttgcgatttcggtgtgtctggagagttt
ggaaccaaaggcgacgccaacacattcattggcacatcgtactacatggcacccgagcgc
atcactggacagagctacaccatcacaagtgatgtgtggagcttgggtgtgactctactt
gaagttgcacagcatcgattcccattcccggcggacggcacggagatgcaaccccgtgct
ggtctcatcgatctgctcacatacattgttcgacaaccaatcccgaaactcaaggatgag
cccgaagctggtatcaagtggacagagaatttcaaatacttcatcgagtgctgtctcgag
aaagaatgcccgcggagagcgacaccatggcgtatgctcgaacacccttggatggtggag
atgaagtcaaagaaagtcaacatggcacatttcctcaagcaggtgtgggactggcaagac
taa

DBGET integrated database retrieval system