KEGG   Phaeosphaeria nodorum: SNOG_11942Help
Entry
SNOG_11942        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
pno  Phaeosphaeria nodorum
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pno00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    SNOG_11942
Enzymes [BR:pno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SNOG_11942
Peptidases [BR:pno01002]
 Metallo Peptidases
  Family M67
   SNOG_11942
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 722 aa AA seqDB search
MASFFENLWQSIFTPGPTPTLLVATNASFAALQVLLFAMLLATYSIHFIILSFLCGGLWW
AINWFAAEIRAAQAKEEEAKRIREARRGKDKGEKGTDAGDEGEGMDSGDDTEVDNELEVQ
KQRPTQARSARPESQSTVLVDRPSERSRREETPQASAGAGGPAAASTTGATTKLAPLVDD
ALKKRKGLGESTGDLSTDSEWEKLDSIFEFKLLGRGDISLVLLAIKLMPDVRGSTLLLAP
LPKHPSQCPDTSPPLAVYPAAFATYSTMASINAPVSIADVVAQAGNYTYNAQIPLASWLR
TASTMQKEAQVYEAEGNDPQTYLLLYRHADLVLQHLQTHPDRNQPQNKKALNAATTTVYS
DLKKLETIAPRIKKRHEEFQERRRKQQDALKALEGSGAANLPQELDGLSLQDRGSRRRRS
YDSRPTLDASENHSLATRLAQREHGVSEEEEQQRRTGGRWESWQDDLAHDDGRGDLMNQL
QEVARLQQNGANGQKSSYSEVSYIDSILPGKVLDDRPPTPSTELDSFSFKPSAYLENGDP
LRPVFLPSQLRQQFLAVASSNTRLNLETCGMLCGILKSNAMFITRLVVPEQTSTSDTCET
LNEEEFFDYCDKEELLVIGWIHTHPSQTCFMSSRDLHTHVGYQVMMPESVAIVCAPSKTP
SWGCFRLTDPPGKQAILNCSKPGIFHPHDVENIYTEAVKPGHVVELVNAPLEIVDMRPKK
KF
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcctttttcgagaacctgtggcagtccatcttcacgccgggccccacgcccacg
ctcctcgtcgcgaccaacgcatccttcgcggcgctgcaagttctcttgtttgccatgctg
ctggcgacatacagcatacacttcatcatcctgtccttcctctgcggcggcctctggtgg
gccatcaactggtttgcagccgagatccgcgccgcgcaggccaaagaggaggaagcgaag
cgcatacgggaggcgcgccggggcaaagacaagggcgagaagggcacggatgcaggcgac
gagggcgagggcatggactcgggagacgacactgaggtggataatgaactcgaggtgcag
aaacagcggcccacgcaagcacgctctgcgcgaccggaatctcagagcaccgtccttgtc
gaccggcccagcgagcgcagccggagggaagaaacgccccaggcttcggcgggagcgggg
ggtcccgccgctgcgagtacgacgggcgcgacgacgaaacttgcgccgctggtggatgat
gcgctgaagaagaggaagggcttgggcgagtcgacaggcgatctgagcacggattcggag
tgggagaaactcgattccatcttcgagttcaaattgcttgggcgcggcgatatatccctc
gtcttgctcgcaatcaagttgatgcccgatgttcgaggttcgaccttgctgcttgccccg
ctgccgaaacatccatcacagtgccctgacacatcaccaccacttgctgtctaccccgcg
gcattcgcgacttactccaccatggcctcgatcaacgcgcccgtgagcattgcagacgtc
gtcgcacaggcgggcaactacacatacaatgcgcagattccactggcgagctggctgcgc
acagctagtaccatgcagaaagaggcgcaagtctacgaagcggaaggcaatgacccacag
acatacctcctcctataccgccacgccgacctcgtgctccaacacctgcagacacaccca
gacagaaatcagccgcagaataagaaggcgctcaatgcggcgacgacgacagtgtatagc
gacttgaagaagctggagacgattgcgccgaggattaagaagaggcatgaggagttccag
gagaggaggaggaagcagcaagacgcgctgaaagcacttgagggcagtggcgcggcgaac
ttgccgcaggagttggatgggttgtcgttacaggatcgagggtcgaggaggaggaggtcg
tatgattctaggcctacgctggatgcgtcggagaatcactccctggcgacaagactggcg
cagagggagcatggcgtttcggaagaggaggagcaacagcgacgaacaggaggtaggtgg
gagagctggcaggacgatctcgcacacgatgatggccgcggagacctcatgaatcagctt
caggaggttgcacgcctacagcagaatggagcgaatgggcagaagtcatcgtactctgaa
gtaagctacatcgactctatcctccctggcaaggtcctcgacgaccgccctcccacgccc
tcaacggaattagactccttctccttcaaaccctccgcctacctcgaaaatggtgacccc
ctgcgccccgtattcctcccctcccaactgcgccaacaattcctcgccgtcgcatcctcc
aatacgcgcctcaacctcgaaacatgcggcatgctctgcggcatcttgaaatccaatgct
atgttcatcacgcggctggtcgtgcctgagcaaacctcgacgtctgatacgtgcgagacg
ctgaacgaggaggagtttttcgactactgcgataaagaggaattgcttgtgattggctgg
atacacacgcaccccagtcagacatgctttatgagtagtcgcgatttgcatacgcatgtg
ggctatcaggttatgatgcccgagagcgtggcgattgtttgtgcgccgagtaagacgcct
agctggggctgcttccgcctgaccgatccgccgggcaagcaggccatcttgaactgctcg
aaacccggcattttccacccgcatgatgtggagaatatttataccgaggcggttaagccg
gggcatgttgttgagctcgtcaacgcgccgttggagattgtggatatgaggccgaagaag
aagttttag

DBGET integrated database retrieval system