KEGG   Phaeosphaeria nodorum: SNOG_12120Help
Entry
SNOG_12120        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.4.19.12]
Organism
pno  Phaeosphaeria nodorum
Brite
Enzymes [BR:pno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SNOG_12120
Peptidases [BR:pno01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SNOG_12120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1048 aa AA seqDB search
MKPPHLSENDIETLTNKAQLRKRWEDAKRIAGERADTVMARSVDGLDYLNTYLLDALNPV
KGKARIPLLNKKFLKTFGRDCDSILQRLGFTTELEVQGDPSSRVWYLPRPAESQGPLETT
LRNTIEDTRYELNTIILKSPENDRVGAPKNPLFPTPAGAHIERALACDNCMCSFNFLALT
NTARRQSPRPHCECYAALGAVGDFSDALILFAFAQQIVVDVESRSYYYECLQDLAVGRKS
EELQIQVATYGSQGFTSRRELDAAYKSFGIEPAHAKHLNDEHIIGTFRSRLSDISPHMAE
DARRQLRIIGDARNSETIRAEASDALETYEQALSWLDLTEEVADDFVVTMVSLKTGDKLG
SLDTARKAVSIIAEHRNSSRLRQWLKEGSMDQPEMDMGEAYALFSISDRTAKVDFDVMKT
TIAFAPPESAEKMQKAYQMIEQDQATNFNNRSNQSEVRRNDYPLETWPVGLRNIGNTCYL
NSVLQFLFTIKPLRDLVLNCDEYLQDPSPEALRGKKVGRTDVTADRVEVAQKFIRELRTF
FNHMITAPTDTVQPAIDIAALALCKTDTPQSEPKSPGPDSKKDDSLGSIEGAPVIGPMLA
PANDSALAATSTADSVMGDDNSDTSMQAMNLQGPSQDATSAPPAAPTRPPPIPPRPAVPT
KSKIGNIEESARQQDAAEVLGNIFDLFSCAIKGKGLLREDEQLDMIKELFFSDVTSVRNT
KPKPEESHELRDHFLVSPGWRDRNLYATLDDDFGQSEMEGGITKYDYIRQAAPVQIINLR
RLQFDKEKGEQVYDRSHIGLEKTLYLDRYLEKTQSLPQLELLKLREAQWEKQGQLRLYEQ
RRDALRRTDVEGLDLAESVDEASAFIADLSKQYEEQADDALPTPPPELADALTEKAQLLK
KDLAQMDVQMTSLEAEIDSLFKESRDHPYRLHAVFTHRGGTKGGHYWIYIYDFQNNLWRK
YNDDHVTLVTESDIFDREIAAMPSASTGVVYIREDLIHTITEAVRREPLPVEAETQGDVH
MRDADDAIPQLEPVAYNDVQVIDGVEKS
NT seq 3147 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccccgcacctttccgagaacgacatcgagaccttgacaaacaaggcgcagctg
cgaaagaggtgggaggatgcaaaacggatagcgggcgaacgtgctgataccgtcatggct
cggagtgtcgatgggctcgactacctcaacacctacctgcttgacgccctcaacccagtc
aagggcaaggcgcggatcccgctcctcaacaagaagttcctcaagactttcggcagagat
tgcgactcgatactccagcgtcttgggttcacgaccgagctggaagtccagggtgatcct
tccagtcgagtatggtaccttccacgacctgccgaatcacagggacctctagagacgacg
ctgcgcaacacgatcgaagatacccgctatgagttgaacaccatcatccttaagagtcca
gagaacgaccgtgttggcgcaccaaagaacccattattccctacacctgcaggagcccat
atcgaaagagccctggcttgtgacaactgtatgtgctctttcaattttctggcgctcact
aacacagccagacgacagagtcccaggccgcactgcgagtgttatgccgctcttggtgcg
gtcggtgatttttcggacgcgctaatcttgtttgcgtttgctcagcagattgttgtcgat
gtggaaagccgctcctactattacgaatgtctacaagacctcgccgttggccgcaaaagt
gaagaactgcaaatacaggtcgccacctacggttcgcagggttttacaagcagacgtgag
cttgacgccgcatacaaatcctttggcatcgagccagcacacgccaaacacctcaacgac
gagcacatcattggcactttcagatcaagactttccgacatcagtccacacatggccgag
gatgcacgcagacagctgcgcatcattggtgacgcacgcaacagcgaaaccatccgggcg
gaagcttccgatgctttggagacttatgagcaggcattgtcatggctagacctgacggaa
gaagtagccgatgacttcgttgtcaccatggtctctctcaagactggagacaagcttggc
tcactcgatactgcccgcaaagctgtatcgataattgcagaacaccgaaatagcagccgc
ttacgccaatggctcaaggaaggcagtatggatcagcccgagatggatatgggcgaggca
tatgccctgttctctatcagcgatcggactgccaaggtcgacttcgacgtcatgaagacc
acaatagcctttgcgccaccagagagcgccgaaaagatgcaaaaagcttatcaaatgatt
gagcaagatcaggcgacaaacttcaacaacagatcgaatcaatcagaagtgcgccgtaac
gactaccctcttgagacctggccggttggtctccggaatattggaaacacttgctatctc
aacagcgtccttcaatttctcttcacgatcaaaccgcttcgagacctagttctgaactgt
gacgagtacctccaagacccatcaccagaggccttgaggggaaagaaggtcggccgtacc
gatgtgaccgctgatagggtagaggtcgctcaaaagttcattcgcgagttacggactttc
ttcaatcacatgatcacagcgcctacagacactgtgcagccagcgatagatattgctgca
ttggcactatgcaagacagacactccgcagtcggaaccgaaatcaccaggccctgatagc
aagaaagatgatagtttgggttcaatcgaaggggcacctgtgatcggtccaatgctggct
cccgcgaatgacagcgcactcgctgctacatccaccgctgattccgtcatgggagatgat
aacagcgacacttctatgcaagcaatgaatcttcagggtccgtcgcaggatgccacaagc
gcaccaccagctgcgcctactcggccgcctcctattcctccccgaccggcggtgcctacg
aaaagcaaaatcggaaacatcgaagagagtgcccggcaacaagatgctgctgaagtcttg
ggcaacatctttgatctcttctcgtgcgctatcaagggcaagggtcttttgcgtgaagat
gaacagctcgacatgatcaaggagttgttcttcagcgatgtcacttcggtccgcaacaca
aaaccaaaaccagaagagtctcacgagcttcgcgaccacttcttggtgtcgcccggctgg
cgagatcgcaatctctatgctaccctagacgacgattttggtcaaagtgagatggaaggt
ggcatcacgaagtatgattacatccgacaagctgcgcctgttcagatcatcaaccttcga
agattgcagttcgacaaagagaagggcgagcaggtgtatgatcgctcacacattggccta
gagaagacgctctacctggatcggtacctggagaagacacaatcgctgcctcagctcgag
ctcttgaaactccgcgaagcacaatgggagaagcaaggacagttacggctttatgagcaa
cgtcgggacgcattaaggcgaacggatgtcgaagggctggacctcgccgagtctgtcgac
gaagccagtgccttcatcgcagatctgagcaaacagtacgaggagcaagccgacgacgca
ttgccaacgccgccacccgagctcgccgatgccctcaccgagaaggcacagctcctgaaa
aaagaccttgcacaaatggacgtacagatgacttcactcgaagccgagatcgacagtctc
ttcaaggaatcccgcgatcacccgtaccgcctgcacgccgtatttacccatcgtggtggc
actaagggcggccactactggatctacatctacgactttcagaacaacttgtggcgcaag
tacaacgatgaccacgtgacacttgttaccgagagtgatatcttcgaccgcgaaatcgct
gctatgccttctgccagtacgggtgttgtgtacatccgcgaagacttgatccataccatc
accgaagcagttcgcagggagccattaccagtcgaggccgaaacccaaggcgacgtccac
atgcgcgacgcagacgatgcgataccgcagcttgagcccgttgcgtacaatgacgtgcag
gtcatcgacggggttgaaaagtcgtaa

DBGET integrated database retrieval system