KEGG   Phaeosphaeria nodorum: SNOG_12251Help
Entry
SNOG_12251        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
pno  Phaeosphaeria nodorum
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:pno04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 554 aa AA seqDB search
MKYSTICAAFLAAAVTASDVKQLNKDTFKAFVEENDLVLAEFFAPWCGHCKALAPEYETA
ATTLKEKDIALVKIDCTEEQDLCQEYGVEGYPTLKVFRGPENISPYGGQRKADSLISYMT
KQALPAVSDVTKDTLEEFKTADKVVLVAYFAADDKASNETFTEVANGLRDNFLFGATSDA
ALAKAEGVSQPGLVLYKTFDDGKDVFTEKFDAENIKEFAKVASTPLIGEVGPETYSGYMA
AGIPLAYIFAETQEERDDFAKQLKPLALKHKGAVNFATIDAKSFGQHAANLNLKAGTWPA
FAIQRTDKNEKFPYDQDKKITEKDIGTFVEDFLAGKVEPSIKSEPIPESNDGPVSIIVAK
NYQDIVIDNDKDVLVEFYAPWCGHCKALAPKYEELGELYSSDEFKKLVTVAKVDATANDV
PDEIQGFPTIKLFPAGKKDSPVDYSGSRTIEDLVQFIKDNGSHKVAAVYEEAKEKVAEAA
EEASEKAGSVADEATKSAGSAADEATKSAKSGAEKATDAAKDAAKDAAASASSVASEAAK
AAKSAVDAEDHDEL
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaagtactcgactatctgcgctgccttccttgcggctgccgtcacggcatccgatgtc
aagcagctcaacaaggacacattcaaggcctttgtcgaggagaacgacctcgtcctcgcc
gagttcttcgcgccatggtgcggccactgcaaggcgctcgcgcccgagtacgagacggcg
gcgacgacgctgaaggaaaaggacattgcactggtcaagatcgactgcactgaggagcag
gatctgtgccaggagtacggcgtcgagggctaccccaccctcaaggtcttccgcggaccc
gagaacatctcgccctatggcggtcagcgcaaggccgacagcttgatatcgtacatgact
aagcaggccctccctgccgtctccgacgtcaccaaggacaccctcgaggagttcaagacg
gctgacaaggtcgtgctcgttgcctactttgccgccgacgacaaggcctctaacgagacc
tttactgaggtcgccaatggcctccgcgacaacttcctctttggcgccaccagcgacgcc
gccctggccaaggccgagggtgtctcccagcccggcctggtcctctacaagaccttcgac
gacggaaaggacgtcttcactgagaagttcgacgccgagaacatcaaggagttcgccaag
gtcgcctctacccccctcatcggtgaggttggccccgagacgtacagcggctacatggct
gctggcattcctctggcctacatcttcgccgagacccaggaggagcgcgacgacttcgcc
aagcagctgaagcccctcgccctcaagcacaagggtgccgtcaacttcgccaccatcgac
gccaagtcgttcggccagcacgctgctaaccttaacctcaaggctggcacctggcccgct
ttcgccatccagcgcaccgacaagaacgagaagttcccctacgaccaggacaagaagatc
accgagaaggacattggcacttttgtcgaggacttcctcgccggcaaggtcgagcctagc
atcaagtctgagcccatccccgagtcaaacgacggccccgtctctatcattgtcgccaag
aactaccaggacatcgtcatcgacaacgacaaagacgttctggtcgagttctacgccccg
tggtgcggtcactgcaaggctcttgctcccaagtacgaggagctcggtgagctttactct
tccgacgaattcaagaagcttgtcaccgtcgccaaggttgacgctaccgccaacgacgtt
cccgacgagatccagggcttccccaccatcaagctcttccccgctggcaagaaggactca
cctgtcgactactctggctcgaggaccatcgaggaccttgtccagttcatcaaggacaac
ggctcccacaaggttgccgctgtctacgaggaggccaaggagaaggtcgccgaggctgcc
gaggaggcatccgagaaggccggctccgtcgctgacgaggctaccaagtccgctggctca
gccgccgacgaggccaccaagtcggccaagtctggtgctgagaaggccactgacgctgca
aaggatgctgcaaaggacgccgccgcatctgcatcctcagtagcatctgaggccgccaag
gccgcaaagagcgctgtcgatgccgaggaccacgatgagttgtaa

DBGET integrated database retrieval system