KEGG   Phaeosphaeria nodorum: SNOG_12465Help
Entry
SNOG_12465        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pno  Phaeosphaeria nodorum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SNOG_12465
Enzymes [BR:pno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SNOG_12465
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 936 aa AA seqDB search
MVLALLTTACLASLTLASFDANLNYQSPSRRHAGLGIDVPKVAKRSLVKRATPWDPAQLN
FTHGVASGDPYPHSVILWTRIAPSLEHDRSNVTVSGYVDLYSHETEKYIKASPNPVCTEY
RVGTDRNFSSVVDSGTAYTTSDIDFTIKVSVEAKNLEPFQTYYYQFTVCGSSNKSPVGRT
KTSPNEDDSVSKVGLAVFSCSNYPNGYFNAYGNAARKDDVDFFVHLGDYIYEGGKGVAGK
DSRATAPRGEIFSLYDYRTRIGQYRTDLDLRLAHQNFAWITTWDDHEVANNGYRDGFSGM
NNTEASFLKFGRISVDSRKMNAVRAYFEWMPIRQVDLDDNLRIWRNFKMGKLFDLVMLDT
RNYDRSITTLDWNDDYIAELKDDAGRSLMGSRQENWFYRTLSESSDRGAQWRVIGNQIIF
SSVNQTVLYGGDGINADQWDVTGDSHANWVSDLVWLDKTPYDQATGAGAIGVEFAGTAVS
SSGYGAGRSIANASTLAARLVSDNRELQWTEGYYRGYYELHISPEELNARYYATRNPFEV
SLANFTVKAGANHLDRNVAGGRVESGALQRGETVPTNLTLNTATGEWNVTGFEKMFVTYP
AANTTSAPLRIMTRGMEKNLHINDNAPIPVPNDNEILVQVHAMALNPVDHKITESPAPLR
LLGSVFTPGSDFSGKVAEVGKNAEGFTKGQFVFGAKMGEYLNGTLAQYVVVKKELAAVLP
EGVDPQVAATAGICGLTEYQAIAPNVKAGDKVFINGGSGGTGSFGVQIAKALGCHVTTTC
SAANVELCQSLGADEVIDYKSTNIVQSLSSKGPIFKHVVDNIGTPANLYKASNAFISPGG
GFSQIGATPSLGSALQIGSNMLRPGFLGGGKAKYQLLMTQASKPNLEQLGQWMQEGKLKP
VVDSIFEWEDAPKAYEKLKSGRAKGKIVVKVPQDKE
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atggtgctggctttgttaacaacggcctgtttggcctccttgaccctagcctctttcgac
gccaatctcaactatcagtcgccgtcccgaaggcatgctggtcttggtattgacgtgcca
aaagtggcgaagcgaagtctcgtgaagcgtgcaactccgtgggatccagctcaactcaac
tttacgcatggtgtggcatcgggcgacccatatccccactcggtcattctttggactcgt
attgcaccatcactggagcacgataggtctaatgtgactgtgtctggctacgtcgattta
tacagccatgagacagaaaagtacatcaaagcttcgccgaaccccgtctgtactgagtac
cgcgtcggaacggacaggaacttttcgagtgtagtcgacagcggtacagcttacactacc
tcagatatcgacttcaccatcaaggtcagtgttgaggcgaagaacttggaaccctttcag
acatactactaccaattcaccgtgtgcggttcaagcaacaagagtccagtaggaagaaca
aagaccagcccgaacgaggacgacagtgtgtccaaagtaggtctggctgtgttctcgtgc
agcaactacccgaatggatacttcaacgcttatggtaatgcggcacgtaaagatgatgtg
gacttctttgtccatctcggagactacatatatgagggcgggaaaggagtcgctggtaaa
gattcacgcgcaactgctcctcgcggagagattttcagcctgtatgattaccggacccgt
atcggccagtatcgtacagacctggacttgcgtcttgcccatcagaactttgcttggatc
acaacatgggatgatcatgaggtggcaaacaatggctacagagatggctttagcggcatg
aataatactgaggcttcattcttgaagttcggccgcatcagtgtcgactcgcggaagatg
aacgctgtacgtgcctactttgagtggatgcctattcgtcaggtcgacttggatgacaat
ctccgtatctggaggaacttcaagatgggcaagctctttgatttagtcatgctggacact
cgtaactacgaccgtagcattaccacacttgactggaacgatgattacattgcggagctg
aaggacgatgctggccgttcgcttatggggagccgccaggagaactggttttatcgaact
ttatccgagtcaagcgaccggggcgctcagtggagggtcatcggtaaccagatcattttc
agtagcgtgaaccaaaccgtattatacggtggagatggcatcaacgcagaccagtgggat
gtaactggtgactcccatgcaaactgggtgtcagacctcgtatggctcgacaagactccc
tacgaccaagctactggtgctggcgcaatcggtgtcgaatttgccggtactgccgtatcc
tcaagcggttatggagcaggtcgtagcatcgccaatgccagcacgcttgcagcccgactc
gttagtgataacagggagcttcaatggactgaaggatactaccgcgggtactacgaactt
cacatctctcccgaagagctgaatgctcgttactacgctacccgcaaccctttcgaagtc
agtctggcgaacttcacggtcaaggctggcgccaaccaccttgaccgaaacgtcgcggga
ggtcgtgtcgagagcggtgcacttcagagaggcgagactgtgccgacgaatttgactttg
aacactgcgacaggtgaatggaatgtgacgggcttcgagaagatgtttgtgacttatcca
gccgcaaacacgacaagtgccccactccgcatcatgacgcgaggtatggagaagaacctt
catatcaacgacaacgcgcctataccagtgcccaatgacaacgaaatcctggttcaagtc
cacgccatggccctcaaccccgtcgaccacaaaatcacagagagcccagcaccgctccga
ctcttaggctcagtcttcactccgggctcagatttctccggcaaagttgccgaggttggg
aagaatgctgaagggtttaccaaaggccaatttgtgtttggtgcaaagatgggagagtac
ctcaacggcacccttgcgcaatacgttgttgtgaagaaagaacttgctgccgtcctcccc
gaaggcgttgatcctcaagtagccgccacagcaggaatctgcggattgactgagtaccaa
gccatcgcaccaaacgtcaaggccggagacaaagtcttcatcaacggtggatcaggcggt
acaggcagtttcggtgtgcagatcgcaaaggctttgggctgccatgtcacaacaacatgc
tcagcagccaacgttgagctatgccagagcctcggcgcagacgaagtcatcgactacaag
tcgaccaacatcgttcaatctctctcctccaaaggcccgattttcaagcacgtcgtcgac
aacatcggcacaccagcaaatctctacaaagcctcgaacgcgttcatctcaccgggcgga
ggattttcccaaatcggcgcgactccctcgcttggaagcgctctgcaaattggaagcaat
atgctgcggcctgggttcttgggcggtggaaaggcaaagtatcagttgctcatgacgcaa
gcatcaaagccaaatctcgagcagttgggtcagtggatgcaggagggcaagctcaagcct
gtggtggatagtatatttgagtgggaggatgcgccgaaggcgtatgagaagctaaagagc
ggaagggcaaagggaaagatcgtcgtcaaggtgccgcaagacaaggagtga

DBGET integrated database retrieval system