KEGG   Phaeosphaeria nodorum: SNOG_12636Help
Entry
SNOG_12636        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pno  Phaeosphaeria nodorum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SNOG_12636
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SNOG_12636
Enzymes [BR:pno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SNOG_12636
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 521 aa AA seqDB search
MAVHMRKLPGQLTVVIKLGNYSNNENNLPTRAGTSSIVDEKTHQPLLSILSLIVETACKL
HADGHRVVIVSSGAIGVGLRRMNLPRRPKHLPQVQALAAIGQCRLMSLWDQLFGNLNQPI
AQVLLTRNDIADRTQYQNAQNTFIELLSMGVIPIVNENDTLAVTEIKFGDNDTLSAITAG
MVQADYLFLMTDVDCLYDKNPRSNPDAKAIEVVEDIAELAADVSSAGSSLGTGGMSTKIV
AARLATSAGVTTIITKSSKPGNIGAIMRHAEQERKKGMSSRNSTSNLQDHNDGVPLAQTA
ALNLHNSNHDLSASTSSLDQAPLSPSLHADSDTVPLHTRFLPISHPIRDRYFWILHGLAP
HGTIYIDQGAWNALNDKAGLLPVGIVDVDGHFAQQEAVRIVVVKRLPKSSPKSLPTTPAA
SSHGVHAPIPMRHPLPHSSSSYAREEGPRPYELHNPAPMEIGRAVVNYSAVEIRRIMGLH
STQIREALGYADSEYVALRENIAFTGRERSRPSTPDHRLEN
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggccgttcacatgcgaaagctgcccggccagctcaccgtcgtcatcaaactcggtaac
tactcaaataacgagaacaacttaccaacacgcgcaggaacctcttccatagtcgacgaa
aaaacgcaccagcccctcctctccatcctctccctcatcgtcgaaacagcatgtaaactg
cacgctgatggccaccgcgtcgtcattgtctcgtcgggcgccattggcgtgggtctcagg
cgcatgaacctaccgcgacgaccgaaacatcttccccaggtacaggcgcttgctgcgatt
gggcaatgtcggctgatgtcgctgtgggatcaattgtttggcaacttgaaccagccgatt
gcgcaggtgctgcttacaagaaatgacattgcagaccggacgcagtatcaaaatgcacag
aacacgtttattgaactgctaagcatgggcgttataccgattgtgaatgagaacgacaca
ttggcggtcacggagatcaaattcggagacaacgatacgctgagtgcaatcacggcggga
atggtacaggccgactatctgttcttaatgacggacgtcgattgcctgtatgacaagaac
cctagaagcaatccagatgcaaaggctatcgaggtcgtggaagacatcgctgagttggca
gcggacgtgagctcagcagggagctccttggggacaggcggcatgagcaccaagatcgtg
gcagcgcgattggcgacgagtgcaggtgtaacaaccatcataacaaagagcagcaagcca
gggaatatcggcgccatcatgagacacgcagagcaagagcggaagaaaggcatgtccagt
cgcaattccaccagcaaccttcaagaccacaacgacggcgtcccactcgcccaaaccgca
gctctaaacctccacaactcaaaccacgacctctctgcatcgaccagctccctcgaccaa
gcccccctctccccatcactacatgcagactccgacaccgtccccctccacacccgcttc
ctcccaatctcccaccccatccgcgaccgctacttctggatcctacacggcctcgcgccc
cacggcacaatctacatcgaccaaggcgcgtggaacgcactgaacgacaaagccggcctc
ctccccgtcggcatcgtcgacgtcgacggccacttcgcccaacaagaagccgtgcgcatc
gtcgtcgtcaagcggctccccaaatcttcaccaaaaagccttcccaccacacccgccgcg
tcttcccacggcgtgcacgccccgattcccatgcgtcacccattgccgcactcgtcatct
tcatatgcccgcgaagaagggcccaggccgtatgaattgcacaacccggcgccgatggag
attggccgcgcggtggtgaattactcggcggtcgagatcaggaggatcatggggctgcat
tcaacgcagattcgcgaggcgctggggtatgcggatagcgagtatgtggcgttgagggag
aatattgcgtttacggggagggagaggagtaggcccagtacgccggatcatcggttggaa
aattag

DBGET integrated database retrieval system