KEGG   Phaeosphaeria nodorum: SNOG_12642Help
Entry
SNOG_12642        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
pno  Phaeosphaeria nodorum
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SNOG_12642
   00500 Starch and sucrose metabolism
    SNOG_12642
Enzymes [BR:pno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     SNOG_12642
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 335 aa AA seqDB search
MLSLLIVLALAVATVAAPPPPVSRAGRPSAPPGCLAVGSSSQYKTVQSAVNALSTTSTTA
QCIFIAKGTYKEQVYVQALKSPLTIYGETTDTSSFSANTVTITQGKSQDDTPTNDETATL
RAHTANLKVYNINLVNTRGSGSQALALSAYSGKQGYYGCQFKGFQDTILAQEGTQVYAKS
YIEGATDFIFGQKGQAWFHAVDIRVLTASVGYITANGRESATNPSYYVINKSTISAASGN
NVKAGTYFLGRPWRNFSRVVFQNTSMTNVINSAGWTIWNTGDPRTDNVEYGEFGNTGDGS
KGTRASFSKKLSKAVAIETVLGSDYKSWVDTAYVS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgctttcccttctcattgtccttgccctagcagtggccactgtagctgcacctccccct
cccgtttcacgcgcaggaagaccctcggctcccccgggttgtcttgcggtagggagttcc
agccaatacaagacggtacaatctgctgtcaacgcgttgagcacgactagtaccacagct
cagtgcatcttcatcgccaaaggcacgtacaaagagcaggtatacgtgcaggcacttaaa
tccccgttgaccatctacggcgagactacggacacctccagcttctcagcaaacacggta
accatcacgcaaggcaagagccaggatgacacgccaaccaatgacgaaaccgccactctc
cgcgctcacacggcgaatttgaaggtctacaacatcaacctagtcaacacccgtggttcc
ggctcacaggccttagccttgagtgcctacagtggcaagcaaggctactatggttgtcag
ttcaaaggcttccaagacaccattcttgcgcaggagggtactcaagtctacgcaaagtcc
tacattgaaggtgcgacggatttcatcttcggtcaaaaggggcaggcatggttccatgct
gtggacatccgcgttcttaccgcctcagtcggctatattacggccaacggccgtgagtcg
gctacgaacccatcatactacgtcatcaacaagtcgaccatttctgctgctagcggaaac
aacgtgaaggccggtacatactttcttggtcgcccatggagaaacttttcgcgcgttgtg
ttccagaacacaagcatgacgaatgtgattaatagcgccggctggacgatatggaatacg
ggagacccgcgcactgacaatgtagagtatggcgagttcggcaacacgggcgacggttcg
aagggcacaagggcaagcttctcaaagaagctcagcaaagcagttgctatcgagactgtc
ctggggagtgactataagagctgggttgacacggcctatgtctcttag

DBGET integrated database retrieval system