KEGG   Parastagonospora nodorum: SNOG_12689Help
Entry
SNOG_12689        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pno  Parastagonospora nodorum
Pathway
pno00010  Glycolysis / Gluconeogenesis
pno00051  Fructose and mannose metabolism
pno00562  Inositol phosphate metabolism
pno01100  Metabolic pathways
pno01110  Biosynthesis of secondary metabolites
pno01130  Biosynthesis of antibiotics
pno01200  Carbon metabolism
pno01230  Biosynthesis of amino acids
Module
pno_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pno_M00002  Glycolysis, core module involving three-carbon compounds
pno_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SNOG_12689
   00051 Fructose and mannose metabolism
    SNOG_12689
   00562 Inositol phosphate metabolism
    SNOG_12689
Enzymes [BR:pno01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SNOG_12689
Exosome [BR:pno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SNOG_12689
  Exosomal proteins of bladder cancer cells
   SNOG_12689
  Exosomal proteins of melanoma cells
   SNOG_12689
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 5979821
NCBI-ProteinID: XP_001802910
UniProt: Q0U6C5
Position
Unknown
AA seq 255 aa AA seqDB search
MPPISRPRRIVGVSLKMYFDLPSTLSYVRGVLQLDGDAWNSRIDLFVIPDFVSLTESRRI
LEPSSIMLGAQDTFWEDKGAYTGEVSPLVLHQAGARIVEIGHAERRAQFGETDDWVAKKA
GAAARNGLIPLVCIGERTHHSVASAAVGAAIAECKPQVMSVLAAVPDDTEVILAYEPVWA
IGASEPADPDHVVNVTKELRNLAGGRAGVVRIVYGGSAGPGTFAKISEGVDGLFLGRFAH
DIQNLKKVIEEVGGA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctatctcacggccccgccgcatcgtgggcgtgtccctgaagatgtatttcgac
ctccccagcacgctctcctatgtgcgtggagtgctgcagctcgacggcgacgcctggaac
tcgcgaattgacctcttcgtcatccccgacttcgtctcgctgaccgagtcccgccgcatc
ctcgaaccctcctccatcatgctcggtgcccaagataccttctgggaagacaagggcgct
tacacgggcgaagtcagcccgctcgtactgcaccaggctggcgcgaggatcgttgagatt
ggacatgctgagcgacgggcacagtttggcgagacggacgactgggtcgcgaagaaggcg
ggtgccgcagcgaggaacggcttgattcctctagtgtgcattggcgagcggacacaccac
agcgtcgcatctgcggccgtgggtgcagccatcgctgagtgcaaacctcaggtcatgtcg
gtgctggctgcagtgcctgacgacaccgaggtcatactggcctatgagcctgtttgggcc
attggcgcaagtgagcctgcggatcccgaccacgtcgtcaacgtcacgaaagagctcagg
aatctggcaggtggacgagctggcgttgtaagaatcgtctacggtggcagtgcaggaccg
ggcacctttgcgaagatctcagaaggtgtcgatggcctgttcttgggtcgctttgcccat
gacatccagaacctgaagaaggtcattgaagaggtaggaggtgcttga

DBGET integrated database retrieval system