KEGG   Phaeosphaeria nodorum: SNOG_13001Help
Entry
SNOG_13001        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
pno  Phaeosphaeria nodorum
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:pno04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 503 aa AA seqDB search
MPTLGFLKKKRTKDSQGSNDLNSPTSPVDSSTPLTPTTSKRTSGSFHLHKTKTNDSTKAA
PTTSPPAAAASQHKPADSMNPAGYGQPAQQQQHQQQQQHQQQQQHHPHAQPLASPHSQPQ
ASHNTPSIQNLIHPNNTNTASASEPPQNGAAVQFQTQPLAQTRVTKGKYSLTDFQIQRTL
GTGSFGRVHLVQSKHNQRFYAVKVLKKAQVVKMKQVEHTNDERRMLQQVKHPFLITLWGT
FQDSKNLYMVMDFVEGGELFSLLRKSQRFPNPVAKFYAAEVTLALDYLHSHNIIYRDLKP
ENLLLDRHGHLKITDFGFAKEVPDITWTLCGTPDYLAPEVVASKGYNKSVDWWSLGILIF
EMLCGFTPFWDGGSPMKIYENILKSRVKYPPYIHPDAHDLLQKLITPDLTKRLGNLHGGS
KDVMNHPWFAEVTWDRLQKKDIDAPYVPPVRAGVGDASQFDKYPEETEAYGQAGDDPCVQ
SPPYTVDHILTCPNSHGHLFPDF
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccctcggattcctcaagaagaagcggacgaaggactcgcagggctccaacgat
ctcaacagcccgacctcgcccgtcgactcgtcgacgccgctgacgcccacgacgtcgaag
cgcacctcgggctccttccacctgcacaagaccaagacgaacgactcgaccaaggcggcg
ccgaccaccagcccgcccgccgccgccgcgtcgcagcacaagcccgccgactcgatgaac
cccgcgggctacggccagccggcgcagcagcaacagcaccagcagcaacagcagcaccag
cagcaacagcagcaccacccacacgcacagccgctggccagcccccactcgcagccgcag
gcctcgcacaacacgcccagcatccagaacctgatacaccccaacaacaccaacaccgcc
agcgcctcggagcccccccagaatggcgccgccgtgcagttccagacgcagcccctcgcg
cagacccgcgtcaccaagggcaagtactccctcactgacttccagatccagcgcaccctc
ggcaccggcagcttcggccgcgtgcacctcgtgcagtccaagcacaaccagcgcttctac
gccgtcaaggtgctgaagaaggcccaggtcgtcaagatgaagcaggtcgagcacaccaac
gacgagcgccgcatgctgcagcaggtcaagcaccccttcctcatcaccctgtggggcacc
ttccaggactcgaagaacctgtacatggtcatggatttcgtcgaaggcggcgagctgttt
agtctgctgcgcaagtcccagcgcttccccaaccccgtcgcaaagttctacgccgccgag
gtcaccctcgccctcgactacctgcactcgcacaacatcatctaccgcgacctgaagccc
gagaacctgctgctcgaccgccacggccacctcaagattaccgacttcggctttgccaag
gaagtgcccgacatcacatggacgctctgtggaacgcccgactacctggcgcctgaagtc
gttgcgtccaagggctacaacaagtccgtggactggtggtcactcggcatcctcatcttc
gaaatgctgtgcggcttcacccccttctgggacggcggctcgcccatgaagatctacgaa
aatatcctcaaatcgcgtgtcaaatacccgccctacatccacccagacgcgcacgacctg
ctgcagaagctcatcacccccgacctgaccaagcgactgggcaatctccacggcggcagc
aaggacgtgatgaaccacccgtggtttgcggaagtcacctgggatcggttgcagaagaag
gacattgacgcgccctatgtgccgccggtcagagctggcgtcggcgacgctagccagttc
gataagtatccagaagagacggaagcatatggacaagccggtgatgacccgtgcgtgcag
agtcctccttacactgtagaccacattctgacgtgtccgaatagccacgggcacttgttt
ccggacttctag

DBGET integrated database retrieval system