KEGG   Parastagonospora nodorum: SNOG_13001Help
Entry
SNOG_13001        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
Organism
pno  Parastagonospora nodorum
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 503 aa AA seqDB search
MPTLGFLKKKRTKDSQGSNDLNSPTSPVDSSTPLTPTTSKRTSGSFHLHKTKTNDSTKAA
PTTSPPAAAASQHKPADSMNPAGYGQPAQQQQHQQQQQHQQQQQHHPHAQPLASPHSQPQ
ASHNTPSIQNLIHPNNTNTASASEPPQNGAAVQFQTQPLAQTRVTKGKYSLTDFQIQRTL
GTGSFGRVHLVQSKHNQRFYAVKVLKKAQVVKMKQVEHTNDERRMLQQVKHPFLITLWGT
FQDSKNLYMVMDFVEGGELFSLLRKSQRFPNPVAKFYAAEVTLALDYLHSHNIIYRDLKP
ENLLLDRHGHLKITDFGFAKEVPDITWTLCGTPDYLAPEVVASKGYNKSVDWWSLGILIF
EMLCGFTPFWDGGSPMKIYENILKSRVKYPPYIHPDAHDLLQKLITPDLTKRLGNLHGGS
KDVMNHPWFAEVTWDRLQKKDIDAPYVPPVRAGVGDASQFDKYPEETEAYGQAGDDPCVQ
SPPYTVDHILTCPNSHGHLFPDF
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccctcggattcctcaagaagaagcggacgaaggactcgcagggctccaacgat
ctcaacagcccgacctcgcccgtcgactcgtcgacgccgctgacgcccacgacgtcgaag
cgcacctcgggctccttccacctgcacaagaccaagacgaacgactcgaccaaggcggcg
ccgaccaccagcccgcccgccgccgccgcgtcgcagcacaagcccgccgactcgatgaac
cccgcgggctacggccagccggcgcagcagcaacagcaccagcagcaacagcagcaccag
cagcaacagcagcaccacccacacgcacagccgctggccagcccccactcgcagccgcag
gcctcgcacaacacgcccagcatccagaacctgatacaccccaacaacaccaacaccgcc
agcgcctcggagcccccccagaatggcgccgccgtgcagttccagacgcagcccctcgcg
cagacccgcgtcaccaagggcaagtactccctcactgacttccagatccagcgcaccctc
ggcaccggcagcttcggccgcgtgcacctcgtgcagtccaagcacaaccagcgcttctac
gccgtcaaggtgctgaagaaggcccaggtcgtcaagatgaagcaggtcgagcacaccaac
gacgagcgccgcatgctgcagcaggtcaagcaccccttcctcatcaccctgtggggcacc
ttccaggactcgaagaacctgtacatggtcatggatttcgtcgaaggcggcgagctgttt
agtctgctgcgcaagtcccagcgcttccccaaccccgtcgcaaagttctacgccgccgag
gtcaccctcgccctcgactacctgcactcgcacaacatcatctaccgcgacctgaagccc
gagaacctgctgctcgaccgccacggccacctcaagattaccgacttcggctttgccaag
gaagtgcccgacatcacatggacgctctgtggaacgcccgactacctggcgcctgaagtc
gttgcgtccaagggctacaacaagtccgtggactggtggtcactcggcatcctcatcttc
gaaatgctgtgcggcttcacccccttctgggacggcggctcgcccatgaagatctacgaa
aatatcctcaaatcgcgtgtcaaatacccgccctacatccacccagacgcgcacgacctg
ctgcagaagctcatcacccccgacctgaccaagcgactgggcaatctccacggcggcagc
aaggacgtgatgaaccacccgtggtttgcggaagtcacctgggatcggttgcagaagaag
gacattgacgcgccctatgtgccgccggtcagagctggcgtcggcgacgctagccagttc
gataagtatccagaagagacggaagcatatggacaagccggtgatgacccgtgcgtgcag
agtcctccttacactgtagaccacattctgacgtgtccgaatagccacgggcacttgttt
ccggacttctag

DBGET integrated database retrieval system