KEGG   Phaeosphaeria nodorum: SNOG_13103Help
Entry
SNOG_13103        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
pno  Phaeosphaeria nodorum
Brite
Enzymes [BR:pno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     SNOG_13103
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 606 aa AA seqDB search
MKPASCLLFSGFAFQAASAATWSPDLRADTNRDGIVDVVGSSDRSNKTAWNAELEAIFLP
NIGDKYLRCANTDKVGNPLSNDELAACNDASGHLLLAPEYVAPLRTVPMNVSDDVAARIY
ATPQAAYERVRLFVLDNPEDKNSTTSWRLVDQEFQFNATQLRAGITLGIDGRELVTNASV
WDGSVVIRFDVFNDLDQSSDSVAMKMAPVLIHHHLQKVETIIATDSNSTNPDQQNFVRQI
EAARQTAGIANQLILFNQSDDIWAQDFIEPGYASMPGPNGPIAIRVILRSAQSTRTGGRQ
VFEQLRGPGVGGFQPSAGTGSGFGHREINSFGNLETIPPYTSKSGESYPVGRIIMGKHFE
EKPAAAVLDFLHDQQLQSPLLLETGWLLIGHVDEFVQFLPYDNELGFTIAIADTVSGMNM
LRKLQTDGHGGIRAISFPGDTGASVPDKNGTINQLLSNATFVEANNYAQRHIDANLQTLL
AEIPLMAEDIIYVPTLFQESNFGSGFGSPDGLPSRFATIPANEKLLVAFSPAAINGIVIG
SQYFSPKPWGPVVNGSDVLERAVEAAYARAGMSVGFVDDFLSHHVGGGEIHCGSNTLRQT
DAIWWE
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccgcatcttgtctcttattctctggcttcgcctttcaggcagcctcggccgca
acatggtcaccggatctccgcgcggacaccaatcgtgatgggattgtcgacgtggtaggc
tcttcagaccgcagcaataagactgcttggaacgctgagcttgaagctatcttccttccc
aacatcggtgacaagtacctgcgttgcgccaacacagacaaagttggcaatccattgagc
aacgatgagctagctgcctgtaacgacgcttctgggcatctactcctggcccccgaatac
gttgcacctcttcgcactgtacccatgaatgtttcggacgatgtggctgctcgcatctac
gccacgccacaagcagcgtacgaacgagttcgactgtttgttctagataatccggaagac
aagaactcaactacatcatggcgtctggtcgaccaagaattccaattcaatgctacccaa
ttgcgcgctggaatcacccttggaatcgatggccgcgaacttgtaacaaatgcgtccgtg
tgggatgggtcggtggttattcgcttcgatgtcttcaacgatctcgaccagtccagcgac
agtgttgcgatgaagatggctccagtcctgatccaccaccatctgcagaaggtagagacg
attatcgctaccgattcaaactccacgaatcctgaccaacagaattttgttcgccaaata
gaggctgctcgtcagactgctggaattgcaaatcagctgatacttttcaatcagtctgat
gatatttgggcgcaagacttcattgaaccgggttacgccagtatgccggggcctaatgga
ccaatcgcaatccgtgttatcctccgctcggcacaatcgacccgtacaggaggccgtcag
gtgttcgagcaacttcgcgggccaggtgttggaggctttcaaccctcagctggcacagga
tctgggtttggccacagggagatcaacagcttcggcaatctggagacaatccccccttac
acttcgaagagtggcgagagctaccccgttggacgcatcatcatgggcaagcactttgaa
gagaaacccgcagctgcagttttggacttcctccatgatcagcagctacagtcgccactt
ctacttgagacaggctggctgctgatcgggcacgttgacgaattcgtacaatttttgcca
tacgataatgaattgggcttcacgatcgctatagcggatacagtatcgggaatgaatatg
ctgaggaagcttcagactgacggacacggcggaatccgtgcaatcagtttcccgggcgac
acaggagcgtcagtgccagataagaacggtacaatcaaccaacttctttctaatgcaaca
ttcgttgaggcgaacaactacgcgcaacgccatattgacgcaaatctacagacgctgtta
gcagaaataccattaatggctgaggacatcatttacgtgcctacgctattccaggaaagt
aatttcggcagcggatttgggtccccggatggactgccatcgcgcttcgccaccattccg
gcgaatgaaaagctgctagtggctttctcccctgctgcaatcaacgggatcgtcatcggg
agccaatatttcagcccgaagccctggggtcctgtggtgaacgggtcggatgtgcttgag
cgagcggtggaagcggcttacgcaagggctggaatgagtgtaggattcgtcgacgacttt
ttgagccatcacgtcggaggaggagagatccactgcggatcgaacaccctccgccagacg
gatgcaatatggtgggagtag

DBGET integrated database retrieval system