KEGG   Phaeosphaeria nodorum: SNOG_13165Help
Entry
SNOG_13165        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
pno  Phaeosphaeria nodorum
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pno00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    SNOG_13165
Enzymes [BR:pno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     SNOG_13165
Peptidases [BR:pno01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SNOG_13165
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 942 aa AA seqDB search
MNGYSNGAHSNGADGSRGSDGAGGPRGASGSYPPIAEIVASASETVEALKHHSIKHLLEQ
GRKHFNGAKILLSSRSPIAGAYWEYLVAYQILVELIPRHRDYYDQIESSRSQTHREFRDL
VKDIKSNEERFVRIKEIIKNDNLRNGALHSRSASTTSLTRSESPSSSSFSRRDDELMLPD
VPTALPSFGLPASPRQKPAIQPKPQNLHGRAVHQSSASINGLSDLTARFANLRGVDTGSA
RSSQDLSVKMPSPADFHSTSRPMGPRDMAPPPLNMPTLNTQYAASLPKEPSPTYSPARNI
SNPSSINPPRSTPRSMNGTGGRSNSIAASSISNHAPNANGVSGSYFPAQQAPREQQGRKG
SVSKTVELEVDAEKLYDYIRMYKMLLIDVRDRAAFDSGHIFASQIMCIEPETLQEGNSAD
QLQERLVISPDEEVAMFDRRHEYDVIVYYDDNTSNADFLGRHARNASERALKCLYDTLHE
FNADKPLSRPPVFLKGGLDAWIDIVGPQALKMSTTSALVASGKTRARAIGRSPAASYVVN
GNQRRSRRQYVPMDEEEEQQWLEEARKGRTAVEQPEAPEEQEEPPAPFYRTTEEFLRRYP
DVEVEQSMIDNWKGTKGILPEAYATLVSNLFKGDVSSVRPSTFRWGIDQQQDAKEFLEFV
LDYMHEDLNVTWNKAPLRPLTDAQEIQREQFPRQYAAKIEWGRYQHRDMSVIGGMFAGQH
ASQLTCQTCGVTSTTYEAFWSLSLEIPNVEACSLRDCLQSYCAAERLAGDELWRCPQCKK
DREAVKKITLTRAPDTLVVHFKRFSASRTESARKIRTPVEFPLQSLDMGPFIEPPMTPKE
EEFIANNARDGHSQLAGIKADPHMNGPFIYNAYAVIWHIGATLGSGHYIAFVKDKAKGTW
RSFNDDKITEFEPANLASQHRLQNEKAYIVFYERERVAGGAF
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgaacggctactcgaatggtgcccacagcaacggtgcagatggctccagaggcagcgat
ggggcaggaggcccgcgaggcgccagtggctcgtacccgcctattgctgagatcgttgcc
tctgcatccgagacggtggaggcgctgaagcatcattcgatcaagcacctgctcgaacag
ggacgcaaacacttcaacggggccaagatactgctgagtagccggagtcccattgcgggc
gcatactgggaataccttgtagcataccagatcctcgtcgagctgatcccccgacatcgc
gactactacgaccagatcgagagcagccgcagccagacccatcgcgaattccgggatctg
gtcaaggacatcaagtccaatgaggagcgcttcgtgcgtatcaaggagatcatcaagaac
gacaacctgcggaatggcgccctacacagcaggtcagcgtccacgacatcgctgacgcgg
tccgagtcgccgagtagctccagcttctcaagaagggacgacgagctgatgcttcccgat
gtgcccactgctctgccaagctttggactacctgcctcacctcgccagaaacctgcaata
cagccgaaaccccagaatcttcacggccgagctgtgcatcagagctctgcgtccatcaat
ggcctcagcgacctcactgcgcgcttcgccaacttacggggcgttgacaccggatctgct
cgctcgagccaagatctgtctgtgaagatgccatctcccgcagatttccattcaacgagt
cgccccatggggccacgcgatatggctccacccccgctcaacatgcctacactcaacaca
cagtacgctgcctcattgccaaaagagccaagccctacttacagccccgcccggaacata
tcgaatccatccagcataaacccgccacgaagcacgccaaggagcatgaatggcaccgga
gggcggagcaattcgattgctgcatcgagcatttcgaaccacgcgcccaacgcgaacggt
gtctctggctcgtacttcccagctcagcaggccccgcgtgaacagcagggaaggaaagga
tctgtcagcaaaaccgtggagcttgaagtcgatgctgaaaagctgtatgactacatccgc
atgtacaagatgcttctcatcgatgtgcgcgaccgggctgcctttgactctggacacatc
ttcgccagccagatcatgtgcatcgagccggaaactttgcaagaaggaaattccgccgac
cagttgcaagagcgtttggtcatctccccagatgaagaagtcgccatgtttgaccgacgg
cacgaatacgacgtgattgtgtactacgacgacaacaccagcaacgccgatttcctcggc
aggcatgcgcggaatgcttccgaaagagccctcaagtgtctctacgacaccctacatgag
ttcaatgcagacaaacctctgagcaggcctccggtcttcctcaagggtggtctggatgct
tggatagacattgttgggccgcaagctttgaagatgtccaccacctcggccctagttgca
agcgggaagacaagagcaagagcaataggacgatccccggccgcaagctatgtcgtcaat
ggcaatcagcggcggtcaagaagacaatatgtcccaatggacgaagaagaggagcaacaa
tggctagaagaagctcgtaagggaagaactgccgttgagcagccagaagcaccagaagag
caggaagagccgcctgctccgttctaccgaaccactgaggagttcttgcgtcggtacccc
gatgttgaagtggaacagtcgatgatagacaactggaagggaaccaagggtatcctgcct
gaggcttacgcaacgttggtgtcaaacttgttcaagggcgatgtcagctcggtgcgacca
agcaccttcaggtggggtatcgaccagcaacaagatgccaaagagtttcttgaatttgtc
ctcgactacatgcacgaagacctaaatgtgacctggaacaaggcgcctctccgacccttg
acagatgctcaggaaatacaacgagaacagttcccgcgccagtacgctgccaagatcgaa
tggggacgttaccagcaccgcgacatgtcggtcattggaggcatgtttgctgggcaacac
gcgtcacagctcacttgtcagacttgtggcgtgacaagcaccacgtatgaagctttctgg
agcttgagcttggaaataccgaacgtcgaagcttgcagcttgcgcgattgcctacagtct
tactgcgcggcggagcgcctagctggcgatgaactttggcgctgccctcagtgcaagaaa
gatcgcgaagccgtcaagaagattacactaacgcgagctcctgacacacttgtcgtccat
ttcaagcggttcagtgcatcgcgaaccgagagcgcgcggaagattaggactcccgtcgaa
tttcccctccaatctctcgacatggggcccttcatcgagcctcccatgacgccaaaggag
gaggagttcatcgcgaacaacgctcgtgatgggcattcacagttggctgggatcaaggcc
gatccacacatgaatgggcctttcatctacaacgcatacgccgtcatctggcacattggc
gcaacgctcggcagcggccactacatcgcattcgtcaaggataaagccaagggcacttgg
cgctcgttcaacgatgataagatcacggagttcgagcctgcgaacctcgcctctcagcat
aggttgcagaacgagaaggcttatattgtcttctacgagcgcgaaagagtcgcaggcgga
gccttctaa

DBGET integrated database retrieval system