KEGG   Phaeosphaeria nodorum: SNOG_13741Help
Entry
SNOG_13741        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
pno  Phaeosphaeria nodorum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 500 aa AA seqDB search
MDLDDWVTNSNECFFLNLYRPGTDSKQPRVFDDSFNPSFTYAVIDENETITGYKNPKIEL
DFRANDLKPRLKIQYDEKLELKDVPDITQVDLSPELFREHLPEPIPDDANVTSKDWKPPG
VLMNSFSVEGKQYEIWKTPLADETARRIWKNMRILVLLFIEGATTEGLDDEETLDRWSLY
LLYDVTPLPKATTTPYTLAGFSTSYRCWIFPTFDIMRATKQLPSPPPEASAEPQKYTPPR
LTQDPETFLFNEKLDRLETSSRERISQFLILPPYQGQSLGAHLYDIIFEDLVKKPFIYEI
PVEDPSEAFDAMRDYSDIVYLRKLPAFQSLSVASNLPPESLRKDSPIPRNQILGNGTDLE
KLRHETKIVSRQFYRMIPSSNRNRARITRKAKSSNENDRKYYFWRLALKHRIYGQNADAL
DQMEVSEKVEKLEAAVDNQQEEYEERLEGLEKRAEFAAGQGSSAGPRTVPKRKRAIVDEE
DEEWEDMDDASVASSKRMKS
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggatctcgacgattgggttaccaactcgaatgagtgcttcttcctcaacctgtaccgc
ccgggcaccgacagcaaacagccgcgcgtgttcgacgactcgttcaaccccagcttcacc
tacgcggtcattgacgagaacgagacaatcacaggatataaaaatcccaaaatcgagcta
gactttcgcgcaaacgatctgaagccaaggctcaagatccagtatgacgagaagctggag
ctcaaggacgtccccgacatcacgcaagtcgacctgtcgcccgagttgttccgcgaacat
ctgccagagcccataccggacgacgcaaatgtgacgtcgaaagattggaagccgccgggc
gtgctcatgaacagcttcagtgttgaagggaagcagtacgagatatggaagacgccgctg
gctgatgagactgcccgtcggatatggaagaacatgcgcatattagtgctgctgttcatt
gaaggagcgacgaccgaagggcttgatgatgaggagacactggaccgctggtcactctac
ctattgtacgacgtcacacctctgcccaaagctaccacgacaccctacacactagccggg
ttctccacatcgtaccgatgctggatcttcccgacctttgacattatgcgcgccactaaa
cagcttccctctccaccaccagaagccagcgctgaaccacaaaagtacacgcctccacgt
cttacacaagatcccgagactttcctcttcaatgagaagctcgaccgtcttgagacgtct
tcccgggagaggatatcgcaattcttgattctgccaccataccagggtcaatcactcggt
gctcacttgtacgacatcatctttgaggacttggtcaagaagccgttcatctatgagatc
ccggtcgaagatccaagcgaggcgttcgatgccatgcgagactacagtgacatcgtctac
ctacgcaagctgcctgccttccaatcgctctccgtcgcatcaaatctgcctcccgagtct
cttcgaaaggactcacctatacctcgaaaccaaatcctcggcaacggcacagatctggag
aaactccgccacgagaccaagattgtctcaagacagttctacagaatgatcccttcctcc
aaccgcaaccgggcgcgaatcacccgcaaggcaaagtcaagcaacgagaacgaccgcaaa
tactacttctggcggttggctctcaagcaccgcatctacggccagaacgcagacgctctg
gaccaaatggaggtgtcggaaaaagtcgaaaagttggaagccgctgtcgacaaccagcag
gaagagtacgaggagcgtctcgagggcttggagaagcgtgctgaattcgctgccggacag
ggctcgtctgctggcccgcgtacagtaccgaagcgcaagagggcgattgtggatgaggaa
gacgaggagtgggaggacatggatgatgcgtcggtggctagctcgaagcggatgaaatcc
tga

DBGET integrated database retrieval system