KEGG   Phaeosphaeria nodorum: SNOG_13852Help
Entry
SNOG_13852        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pno  Phaeosphaeria nodorum
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SNOG_13852
   00670 One carbon pool by folate
    SNOG_13852
Enzymes [BR:pno01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SNOG_13852
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 208 aa AA seqDB search
MPKSPSLTLILAATPSLGIGKGGTLPWPQLKKEMGYFARVTKRVSSPQSTGTRKVNAVLM
GRKTWDSIPPKFRPLKDRLNIVITRKADEFEKTLDKKSDVEGPMVASGIVDALAQLEGKA
EEVDRVYVIGGASVYQTALELPQTRYVLLTKIRKEFECDTFFSVDLEESAVWRRAGREEL
QEFTGEEVKEKVIEEHGVEFEFCLYERV
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaatccccaagcctcaccctcatactcgccgccacaccctcgttaggcataggc
aaaggcggcacactaccatggccacaactaaagaaggaaatgggctactttgcgcgcgtc
acgaagcgcgtctcctctccccaatccacgggcacaagaaaagtcaacgcagtactcatg
ggccgcaagacgtgggatagcataccgccgaaattccggccgctcaaagatcgattgaac
attgtgattacgcgcaaagccgacgagtttgagaagacgctggacaagaagagtgatgtc
gaggggccgatggtagcgtcgggcattgtagatgcgttggcgcaattggaagggaaggcg
gaggaggttgatcgcgtgtatgtcattggtggcgcgagtgtatatcagactgcgctggaa
ctgccgcagacgagatatgtgttgttgacgaagatacggaaggagtttgagtgtgataca
ttcttttcggtggatttggaggagagtgcggtgtggcggagggctgggagggaggagttg
caggagtttacgggtgaggaggtgaaggagaaggtgatcgaggaacatggtgtggagttt
gagttttgtttgtatgaaagagtgtag

DBGET integrated database retrieval system