KEGG   Phaeosphaeria nodorum: SNOG_13852Help
Entry
SNOG_13852        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pno  Phaeosphaeria nodorum
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pno00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:pno00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 208 aa AA seqDB search
MPKSPSLTLILAATPSLGIGKGGTLPWPQLKKEMGYFARVTKRVSSPQSTGTRKVNAVLM
GRKTWDSIPPKFRPLKDRLNIVITRKADEFEKTLDKKSDVEGPMVASGIVDALAQLEGKA
EEVDRVYVIGGASVYQTALELPQTRYVLLTKIRKEFECDTFFSVDLEESAVWRRAGREEL
QEFTGEEVKEKVIEEHGVEFEFCLYERV
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaatccccaagcctcaccctcatactcgccgccacaccctcgttaggcataggc
aaaggcggcacactaccatggccacaactaaagaaggaaatgggctactttgcgcgcgtc
acgaagcgcgtctcctctccccaatccacgggcacaagaaaagtcaacgcagtactcatg
ggccgcaagacgtgggatagcataccgccgaaattccggccgctcaaagatcgattgaac
attgtgattacgcgcaaagccgacgagtttgagaagacgctggacaagaagagtgatgtc
gaggggccgatggtagcgtcgggcattgtagatgcgttggcgcaattggaagggaaggcg
gaggaggttgatcgcgtgtatgtcattggtggcgcgagtgtatatcagactgcgctggaa
ctgccgcagacgagatatgtgttgttgacgaagatacggaaggagtttgagtgtgataca
ttcttttcggtggatttggaggagagtgcggtgtggcggagggctgggagggaggagttg
caggagtttacgggtgaggaggtgaaggagaaggtgatcgaggaacatggtgtggagttt
gagttttgtttgtatgaaagagtgtag

DBGET integrated database retrieval system