KEGG   Phaeosphaeria nodorum: SNOG_14027Help
Entry
SNOG_14027        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
pno  Phaeosphaeria nodorum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SNOG_14027
Enzymes [BR:pno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     SNOG_14027
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 465 aa AA seqDB search
MLVQTIGLVCFALDAAAFAIPPLPHLSHFLGVGQAQKQQQPLQDTLDSWIDKEERIALDK
LLANVAPGGRSVEGKGVVPGTVIASPSTFEDLSGLGEPKFGVDGKPFTGSWGRPQRDGPA
LRALTLMHYLREYNASNPSLWSSSQAAYFFEPYYHASMPPNSVIKADLEYVSHYWNETSF
DLWEEVEGLHFFNLMVSARSLREGSGFARSFGDHGAAEWYEEQAGYIEKLLTKFWNPNKG
HLVETLWSKRSGLDCGLLLGSLHSLPSEESSEEAVYPPWSDEILISLLALTRDQHDRFPI
NSSPSEDQDDGEDAYAFEGTGLGRYPEDVYDGYGNSYRGGNPWFLCTSSAAEVLYRTASH
LSTTSNLTITLLALPFYQSLLATSSLDVEVGTFGSSDALYNSVIEKLKTTGDSFLEVVKA
HVDAEGSMSEQFDGMNGFMRGARDLTWSYGAFLGAVRARKMARDA
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgttggttcagaccattggtctagtatgtttcgctctggatgccgccgccttcgcaatc
ccaccgctgccacatctgagccacttcctaggtgttggtcaggcacagaaacagcagcaa
ccgttacaagatacccttgattcatggatagacaaagaagaacgaatcgcactggacaag
ttgctagcgaacgttgcaccaggtggtagaagtgtcgaaggcaaaggcgttgtgcctggc
acagtaatcgcgagtccaagcaccttcgaagacttgtctggtctaggcgagcccaagttc
ggtgttgatggcaagccttttacaggctcttggggaaggccacaacgtgatgggcccgca
ttacgcgctctaacgctcatgcactacctgcgcgaatacaatgcttcgaatccctctctt
tggtcttcatcacaggctgcatacttcttcgagccatactatcatgcatcaatgccgcca
aatagtgtgatcaaggccgacctggagtatgtgagccattactggaatgagaccagtttc
gacctgtgggaagaagtcgagggactacatttcttcaatctcatggttagcgccaggagt
ttaagagaaggcagtggctttgcaagatcctttggagaccatggggcggcagagtggtat
gaagagcaggcaggatacatcgagaagcttcttaccaaattctggaacccgaacaaaggg
cacctagtcgagacgctctggagcaaaagaagcggcctggactgcggtctacttctcgga
tctttgcattccttgccttctgaagaatcttcagaagaagcggtatatccaccgtggtct
gatgagatcctcatctccctcctcgccttgactcgtgaccagcacgatcgatttccaatc
aacagcagtccatccgaggaccaagatgacggggaagacgcttacgcgttcgaaggtact
ggtcttggtcgctatccagaagacgtgtatgatggttacggcaattcctacaggggtggc
aatccctggtttctgtgcacatcttctgctgccgaagtcttgtatcgcaccgcctcacac
ctctccaccacgtcgaaccttaccatcacgcttctcgccctaccattctaccagtcactt
ctcgcaacttcaagcctcgatgttgaagtgggcacatttggctccagtgacgcactctat
aactcggtcatcgaaaagctcaaaacgactggcgacagtttcctcgaagtcgtcaaagct
catgtggacgctgaaggcagcatgagcgagcagttcgatgggatgaatggctttatgcgc
ggagcaagagatttgacatggagctatggtgcctttttgggcgctgtgagagcaagaaag
atggcgcgggatgcgtga

DBGET integrated database retrieval system