KEGG   Phaeosphaeria nodorum: SNOG_14040Help
Entry
SNOG_14040        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
pno  Phaeosphaeria nodorum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 227 aa AA seqDB search
MVSFTSIVTAAIAATGAMAAPATDVAARSSGDLVARQNTPSSTGTHNGCYYSWWTDNGAQ
ATYTNGAGGSYSVKWGSGGNLVGGKGWNPGSARTITYSGTYSPNGNSYLAIYGWTRNPLV
EYYVVENFGTYDPSSNAQNKGTVTADGSSYKIAQTTRTNQPSIDGTSTFQQYWSVRQNKR
SSGSVNMKTHFDAWTAQGLKLGQHNYQIVATEGYFSTGSASITVNCP
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggtttccttcacctccatcgtaaccgcagccattgctgccaccggcgccatggccgcc
cccgccaccgacgttgctgctcgctcgtctggtgacctcgttgctcgccagaacactccc
tcctccactggcacccacaacggctgctactactcctggtggaccgacaacggcgcccag
gctacctacaccaacggtgctggcggatcctacagcgtcaagtggggctctggcggcaac
ctcgtcggaggaaagggatggaaccctggatctgcccgtaccatcacctactctggtacc
tacagccccaacggcaactcgtacctcgccatctacggctggacccgcaacccgctcgtc
gagtactatgtcgttgagaacttcggcacctacgacccgtcgtccaacgcccagaacaag
ggcaccgtcaccgctgatggctcttcgtacaagattgctcagactactcgtaccaaccag
ccttccatcgacggcacctcgacctttcagcagtactggtctgttcgtcagaacaagcgc
tccagcggttctgtcaacatgaagacccacttcgacgcctggactgcccagggcctcaag
ctcggccagcacaactaccagatcgttgccaccgagggttacttctccaccggcagcgcc
tccatcactgtcaactgcccgtaa

DBGET integrated database retrieval system