KEGG   Phaeosphaeria nodorum: SNOG_14048Help
Entry
SNOG_14048        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
pno  Phaeosphaeria nodorum
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SNOG_14048
   00240 Pyrimidine metabolism
    SNOG_14048
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SNOG_14048
   03410 Base excision repair
    SNOG_14048
   03420 Nucleotide excision repair
    SNOG_14048
   03430 Mismatch repair
    SNOG_14048
   03440 Homologous recombination
    SNOG_14048
DNA repair and recombination proteins [BR:pno03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      SNOG_14048
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 199 aa AA seqDB search
MAPKRRVSGPATKSSQSTLAFHGASNKVTKPSTRTPSGKKNVLAKLVKKQEEAKPEIIEL
IDEPTTAEAALIDQTKVEVVEAQQAQSTPEEEEARRISEAAIEKYWAAKEKLRTAPRVHQ
SDLSLHEKVLREFDMSAQYGPCTGIARLKRWKRAYRINLDPPLEVLAVLLKEMDEDSSVA
LQRSQVDELLNSRVKADAP
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctaagcgacgagtttccggtcccgcgacgaagtcgtcgcaatccaccctcgct
ttccacggcgcatcaaacaaagtcacaaaacccagcacgcgcacaccgagcggaaagaaa
aatgtgctggcaaaattggtgaagaagcaggaggaggccaagccagaaattatcgaactc
atagatgagcccacgacagctgaagcagccctcatcgatcaaaccaaggtagaagtcgtc
gaagcgcaacaagcgcaaagcacacctgaggaagaagaggccaggcgcatatcagaagca
gcgatcgagaagtactgggctgcgaaggagaagctgaggacggcgccgagagtacatcag
tcagatctgagcttgcacgagaaggtcttgcgtgagtttgacatgagcgcacaatacggg
ccctgcactggtatcgcgcgcttgaagcgatggaagcgtgcgtatcgaatcaacctcgac
cccccactggaagtcctagctgttctcttaaaggagatggacgaggattcgagcgtggcg
cttcaacgatcccaagtcgatgaactactaaactcacgagttaaggccgatgctccctga

DBGET integrated database retrieval system