KEGG   Phaeosphaeria nodorum: SNOG_14048Help
Entry
SNOG_14048        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
pno  Phaeosphaeria nodorum
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pno00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pno00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:pno03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:pno03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:pno03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:pno03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pno03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 199 aa AA seqDB search
MAPKRRVSGPATKSSQSTLAFHGASNKVTKPSTRTPSGKKNVLAKLVKKQEEAKPEIIEL
IDEPTTAEAALIDQTKVEVVEAQQAQSTPEEEEARRISEAAIEKYWAAKEKLRTAPRVHQ
SDLSLHEKVLREFDMSAQYGPCTGIARLKRWKRAYRINLDPPLEVLAVLLKEMDEDSSVA
LQRSQVDELLNSRVKADAP
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctaagcgacgagtttccggtcccgcgacgaagtcgtcgcaatccaccctcgct
ttccacggcgcatcaaacaaagtcacaaaacccagcacgcgcacaccgagcggaaagaaa
aatgtgctggcaaaattggtgaagaagcaggaggaggccaagccagaaattatcgaactc
atagatgagcccacgacagctgaagcagccctcatcgatcaaaccaaggtagaagtcgtc
gaagcgcaacaagcgcaaagcacacctgaggaagaagaggccaggcgcatatcagaagca
gcgatcgagaagtactgggctgcgaaggagaagctgaggacggcgccgagagtacatcag
tcagatctgagcttgcacgagaaggtcttgcgtgagtttgacatgagcgcacaatacggg
ccctgcactggtatcgcgcgcttgaagcgatggaagcgtgcgtatcgaatcaacctcgac
cccccactggaagtcctagctgttctcttaaaggagatggacgaggattcgagcgtggcg
cttcaacgatcccaagtcgatgaactactaaactcacgagttaaggccgatgctccctga

DBGET integrated database retrieval system