KEGG   Phaeosphaeria nodorum: SNOG_14553Help
Entry
SNOG_14553        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
pno  Phaeosphaeria nodorum
Brite
Enzymes [BR:pno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     SNOG_14553
Peptidases [BR:pno01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SNOG_14553
Transcription machinery [BR:pno03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     SNOG_14553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 497 aa AA seqDB search
MDSIAVAPKAASLASPKVVKNAKGNIVPSSQMAHIAYGCEHMGEMFENARKQTLIAYQAI
LRNIHEKPSIIAQTHNSSSESKPVVALRPLYLCLQCPSIMTETDRDHHFETKAHCFSVES
REGNVYCGNCQDFIYDPELEIRRLQKGRYIPACKEYNRKKRKFDDTTTADDVKLIVNNST
FLPCRAIGLRGLYNMGQTCFMSVILQTLVHNPFIRNFYLSEGHKQADCEREACVSCALDE
MFVEFYSSDKNEGFGAVSMLMGSWLAGEALAGYQQQDAHEYMQFILNTLHLANGGSTDSD
SDDCKCVVHQTFYGKLSSTVTCDSCRNVTTAQDPYMDLSLDIKNQTKKRKMNADKGDDVP
LDLRDCLERFTAKEKLGSAEYTCRNCDSPQNATKQLSIKRLPPVLAVHLKILKKSLKSTG
APPTNYNTNTPVNSLTYELSSVIVHKGKIDSGHYVSYSREGNDWFMFDDSKVVLASEAEV
LAAEAYLLFYMVSGLEV
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggactccatcgcagtcgctcccaaggcggcgtcactggcgtcgccaaaggtcgtcaag
aatgccaaaggcaacatcgtccccagtagccagatggcgcatatcgcctatggctgcgag
cacatgggcgagatgttcgagaatgcgcgcaagcagacactcatcgcctaccaagccatc
ctacgcaacatacacgagaagccgagtataatagcgcaaacacataattcctcctctgaa
agcaaacctgtcgttgcgctgcggcccctgtacctgtgcttgcaatgtcccagcatcatg
acggagaccgatcgagaccaccacttcgagacgaaggctcactgtttttcggttgaatca
cgagagggcaacgtgtattgtggcaactgccaggacttcatatatgacccagaactcgaa
atcaggaggctacagaaaggtcggtacatacccgcatgtaaggagtataaccgcaagaag
cgcaaattcgacgatacgacgaccgccgacgacgtgaagctgatcgtcaacaactccacg
ttccttccctgccgagcgattggtctacgaggactttacaacatgggtcaaacatgcttt
atgagcgtgatactgcagacactggtgcacaaccccttcatacgaaacttctacctctca
gaagggcacaagcaagccgattgtgaaagggaggcatgtgtgagctgtgcccttgatgag
atgtttgtggagttctactcatcggataagaatgagggcttcggagcagtcagtatgctc
atgggaagctggctggctggcgaggcacttgcaggctaccaacagcaggacgcacatgag
tatatgcaattcattctcaacacactccacctcgcaaacggtggctctaccgattccgat
tccgatgactgcaaatgcgtggtccatcaaactttctatggcaaactttctagtaccgtc
acatgcgacagttgccgcaacgttacaaccgcgcaggatccttacatggacctcagtctc
gacatcaaaaatcaaacaaagaagcgaaagatgaatgctgacaaaggtgatgatgtgccg
cttgacctgagggattgtcttgagaggtttacggcaaaagaaaagctaggttcggcagaa
tatacatgccgaaactgcgatagcccacaaaatgcaacgaagcaactgagcatcaaacga
ctgccaccagtactcgctgttcatctgaagattctcaagaagtctctgaagtcgacaggt
gcaccgcctacgaactataataccaatacgccagtgaacagcctgacctatgagctctcc
tcggtcattgtgcacaaaggcaagatcgactcaggtcattacgtcagttactctcgcgag
ggtaatgactggttcatgttcgacgacagcaaggtagtacttgcaagcgaggcagaagtt
ctagctgctgaggcctacttgttattctacatggtgagcggactagaggtctga

DBGET integrated database retrieval system