KEGG   Phaeosphaeria nodorum: SNOG_14609Help
Entry
SNOG_14609        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pno  Phaeosphaeria nodorum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:pno01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pno00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:pno00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 233 aa AA seqDB search
MSLQVKMNRMRLRIAERLKQSQNTAASLTTFNEVDMSSIMEFRKLYKDEILKNKGVKLGF
MSAFSRACILAMRDVPAVNASIEGPNGGDTIVYRDYVDISVAVATEKGLVTPVVRNAESL
DMVGIEGAIAELGKKARDNKLTIEDMAGGTFTISNGGVFGSLMGTPIINLPQTAVLGLHA
IKDKPVAINGKVEIRPMMYLALTYDHRLLDGREAVTFLVKIKEYIEDPRKMLL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtccttacaggtcaagatgaaccgcatgcgtcttcgcatcgctgagcgtctaaagcag
tcccagaacactgctgcctcgcttaccaccttcaacgaggtcgacatgtcatctatcatg
gaattccgcaagctctacaaggatgagatcctgaagaacaagggtgtcaagctcggcttc
atgtccgccttctcgcgcgcctgcatccttgccatgcgtgatgtgcctgccgtgaacgcc
tcgattgaaggccctaatggaggtgacaccattgtgtaccgcgactacgtcgacatttcc
gttgccgttgcgaccgagaagggtcttgtcacgcctgttgtccggaatgccgagagcctg
gacatggttggcatcgagggcgctatcgccgagctcggcaagaaggcgcgcgacaacaag
ctcaccattgaggacatggctggtggtacattcaccatctcgaatggtggcgttttcggc
agcttgatgggcaccccgatcatcaacctgccacagactgctgttttgggtctgcatgca
atcaaggacaagccagtcgccatcaacggcaaggtcgaaatcaggccgatgatgtacttg
gcccttacctacgaccacaggctgcttgacggtcgggaggccgtgaccttcttggtcaag
atcaaggagtatattgaggaccccaggaagatgcttttgtag

DBGET integrated database retrieval system