KEGG   Phaeosphaeria nodorum: SNOG_14612Help
Entry
SNOG_14612        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
pno  Phaeosphaeria nodorum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 140 aa AA seqDB search
MPPKAQKTPTTGGKAPAGKAPVEKKEAGKKTAAPSGEKKKRTKTRKETYSSYIYKVLKQV
HPDTGISNRAMSILNSFVTTTHIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGEL
AKHAVSEGTKAVTKYSSSTK
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaaagcgcagaagactcccaccaccggcggcaaggccccggctggaaaggca
cccgttgagaagaaggaggctggcaagaagaccgccgctccctctggcgagaagaagaag
cgcaccaagaccaggaaggagacctactcctcatacatctacaaggttctcaagcaggtc
caccccgacactggtatctccaaccgcgccatgagcatcctgaactcgttcgtcaccaca
acgcacatcttcgagcgcgtcgccactgaggcctccaagcttgccgcatacaacaagaag
tccaccatctcgtcgcgcgagatccagacctcagtccgtctgatcctacccggtgaactc
gccaagcacgccgtctctgagggcaccaaggccgtcacaaagtactcttcatccaccaaa
tag

DBGET integrated database retrieval system