KEGG   Phaeosphaeria nodorum: SNOG_15063Help
Entry
SNOG_15063        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
pno  Phaeosphaeria nodorum
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    SNOG_15063
  Amino acid metabolism
   00380 Tryptophan metabolism
    SNOG_15063
Enzymes [BR:pno01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     SNOG_15063
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     SNOG_15063
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 953 aa AA seqDB search
MFSEMHDIASQLVMKWGRHGPEHKIHVVDDFTRLTLDTIALCAMDYRFNSYYYQKMHPFV
DAMSDFLKVSGDRARRDPISQMFYRAETAKYWEDIELLRKTSMEVIKNRRENPTEKKDLL
NGMLNGVDPKTGEKMSDESIMDNMITFLIAGHETTSGLLSFTFYYLLKNPAAYEKAQQEV
DSVIGKGPITVDHLSKVPFLNAVLRESLRLSPTAPSIGLTAKQDTVLGGKYPVKAGAPIL
TLFPLIHRDPLAYGEDAEEFRPERMLDEEFDRRNKEYPNCWKPFGNGMRACIGRPFAWQE
ALLVLAILLQNFNFSMDDASYKLQIKQTLTIKPKDFYMRAHLRNGVSATSLERALQSATL
QEPPPANGGQAVRKQKANKGKPIAIYYGSNTGTCEALANRLASDAANHGFRADVVDTLDA
ARENLPTDKPVVMVTASYEGQPADNAAHFVNWIGTLKDKELEKVSYAVFGCGHRDWAKTF
HKVPKYLNTTLEERGATKLVEMGTTDAASGDIFTDFETWEDQVLWPALREKYGSSEVEGE
GSMEATLDVDISTPRSTILRQDVREARVEEVQVLSANGVAEKRHIEISLPSDMSYSAGDY
LAILPLNPKENIRRATKYFGLSWDSMLTIQSAGPTTLPTDTPISAVDVFGAYVELAQPAS
KRNILTLVDATRDEDTKTQLLRLADSAFTEEITAKRVSVLDLLERFPSVQLPLGVFLKMQ
PPMRVRQYSISSSPLWNPNNVTLTYAVVNQPALSGQGRYVGVATNHLSKLAPGDKLHVSV
RASHQAFHLPKDGKSIPIICIAAGTGLAPFRGFIQERAAQLAAGRTLAPALLFYGCHSPD
SDLLYSDLLKKWEQLGAVSLRFAFSRQPEASEGCKYVQDRMYHDRADIIELFNQGAKLFV
CGSREVGDGAEEMLIKIAKEKFQGEEGREADDKKAREWFEDLRNERFATDVFA
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgttcagcgagatgcacgatatcgcctcgcaactcgtgatgaaatgggggcgccatggg
cctgagcacaagatacacgttgtggacgacttcacccgactgactttggacacgattgca
ttgtgcgccatggactaccgcttcaactcatactactaccagaagatgcatccattcgtg
gatgccatgtcagatttcctgaaggtcagtggcgaccgagcccgaagagacccgatatca
cagatgttctaccgtgcagagactgcgaagtactgggaggacatcgaattattgcgaaaa
acgagtatggaagtcatcaagaacaggagagagaaccccacagaaaagaaggatctcctg
aatggcatgctgaacggagtggaccccaagacgggagagaagatgagtgatgagagcatc
atggacaacatgattaccttcttgatcgctggccacgagacgacgtctggacttctatca
tttacgttctactacctgctcaagaacccagctgcctacgagaaagcacaacaagaggtc
gacagcgtcattggaaagggaccgattaccgtggatcatttgtcgaaggtgccatttctc
aacgcagtgctccgagaatcccttcgtctttcgccaaccgcaccatccattggtttgacg
gcgaaacaggataccgtgcttggcggaaagtaccctgtcaaggcaggcgcgccaatcctc
acccttttccccttgattcatcgcgatccacttgcctacggagaagatgcagaagagttt
cgacctgagcgcatgttggatgaagaattcgaccgccgcaacaaggagtaccccaactgc
tggaagccttttggaaacggaatgcgagcttgtattggacgcccattcgcatggcaagaa
gccctacttgtgcttgcaattctcctgcagaatttcaacttctctatggatgatgcatca
tacaagctgcagatcaagcaaacacttactatcaagcccaaggatttctacatgcgcgcg
catctacggaacggcgtgtcggctaccagtcttgagcgagcacttcagtctgctactcta
caagagcctccacctgctaacggcggccaagcggtcaggaaacaaaaggcgaacaaaggg
aagccgatcgctatctactacggctccaacaccggcacatgcgaagctctcgcaaaccgg
cttgcaagtgatgctgcaaaccatggtttcagggctgatgttgtagacactctcgatgca
gcgcgcgagaacttgcctacagacaagccggtcgtcatggttactgcctcatacgaaggt
cagcctgcagataatgcagctcacttcgtcaactggatcggtacgctcaaagacaaggaa
ttggagaaagtctcgtatgccgtctttggatgcggtcaccgtgactgggccaagacgttc
cacaaagttccaaagtatctgaacactacgctcgaggaacgtggtgctacaaaattagtc
gagatgggcaccaccgatgccgcttcaggggacatctttacagactttgagacctgggaa
gatcaggttctatggcctgctctgcgtgaaaagtatggctcgtctgaggttgaaggcgaa
ggttcaatggaagctactctggacgtggacatcagcacacctcgatcaacgatcttgcgc
caagacgttcgcgaagcgcgtgtagaggaggttcaggtcttgagtgcaaacggtgttgcc
gaaaagaggcacattgagatcagcctgccatcggacatgtcgtactctgctggagattac
ttggcgatattgccgctcaacccgaaggagaacatccgtcgagctaccaagtacttcggt
ctatcgtgggatagcatgttgactattcagtccgctggcccaactacactgcccacggat
acacccatcagtgcagttgatgtcttcggcgcgtatgtggagcttgctcaaccagccagc
aagcgcaacattctcactctcgtcgacgcgactcgcgatgaagacacaaagacacaactc
ttgcgtctcgcagattccgctttcacagaggagatcactgcaaaacgtgtctctgtgctc
gaccttctcgagcgcttcccatccgtccagctgccacttggcgtcttcttgaagatgcag
ccaccgatgcgagtccgccagtacagcatctcctcgtcaccactctggaatccgaacaac
gtcaccctcacatacgccgttgtcaatcaacccgcactcagcggtcaaggacgctacgtc
ggtgtcgcaacaaaccatctctccaagctcgcacccggagacaagctccacgtcagcgtc
cgcgcatcccaccaagctttccatctccccaaggatgggaagtccatcccgattatctgt
atagccgccggtaccggcctcgctcccttccgtggcttcatccaagaacgcgctgctcaa
ctcgccgccgggcgcaccctcgcccctgcgctcctcttctacggctgccactctcccgac
agcgacctcttatattctgaccttctcaagaaatgggaacagctcggcgctgtatcccta
cgctttgcattctcgcgccagcccgaagcatctgaaggttgcaagtatgtgcaagatcgt
atgtatcacgaccgcgcggacatcatcgagttgttcaatcagggcgcgaagttgtttgtg
tgcggaagtcgggaggtgggagatggtgcggaggagatgttgattaagattgctaaggaa
aagtttcagggtgaggaggggagggaagccgatgataagaaggcgagggagtggtttgag
gatttgaggaatgagaggtttgcgacggatgtttttgcttga

DBGET integrated database retrieval system