KEGG   Phaeosphaeria nodorum: SNOG_15063Help
Entry
SNOG_15063        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
pno  Phaeosphaeria nodorum
Pathway
Fatty acid degradation
Tryptophan metabolism
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:pno00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:pno00380]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 953 aa AA seqDB search
MFSEMHDIASQLVMKWGRHGPEHKIHVVDDFTRLTLDTIALCAMDYRFNSYYYQKMHPFV
DAMSDFLKVSGDRARRDPISQMFYRAETAKYWEDIELLRKTSMEVIKNRRENPTEKKDLL
NGMLNGVDPKTGEKMSDESIMDNMITFLIAGHETTSGLLSFTFYYLLKNPAAYEKAQQEV
DSVIGKGPITVDHLSKVPFLNAVLRESLRLSPTAPSIGLTAKQDTVLGGKYPVKAGAPIL
TLFPLIHRDPLAYGEDAEEFRPERMLDEEFDRRNKEYPNCWKPFGNGMRACIGRPFAWQE
ALLVLAILLQNFNFSMDDASYKLQIKQTLTIKPKDFYMRAHLRNGVSATSLERALQSATL
QEPPPANGGQAVRKQKANKGKPIAIYYGSNTGTCEALANRLASDAANHGFRADVVDTLDA
ARENLPTDKPVVMVTASYEGQPADNAAHFVNWIGTLKDKELEKVSYAVFGCGHRDWAKTF
HKVPKYLNTTLEERGATKLVEMGTTDAASGDIFTDFETWEDQVLWPALREKYGSSEVEGE
GSMEATLDVDISTPRSTILRQDVREARVEEVQVLSANGVAEKRHIEISLPSDMSYSAGDY
LAILPLNPKENIRRATKYFGLSWDSMLTIQSAGPTTLPTDTPISAVDVFGAYVELAQPAS
KRNILTLVDATRDEDTKTQLLRLADSAFTEEITAKRVSVLDLLERFPSVQLPLGVFLKMQ
PPMRVRQYSISSSPLWNPNNVTLTYAVVNQPALSGQGRYVGVATNHLSKLAPGDKLHVSV
RASHQAFHLPKDGKSIPIICIAAGTGLAPFRGFIQERAAQLAAGRTLAPALLFYGCHSPD
SDLLYSDLLKKWEQLGAVSLRFAFSRQPEASEGCKYVQDRMYHDRADIIELFNQGAKLFV
CGSREVGDGAEEMLIKIAKEKFQGEEGREADDKKAREWFEDLRNERFATDVFA
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgttcagcgagatgcacgatatcgcctcgcaactcgtgatgaaatgggggcgccatggg
cctgagcacaagatacacgttgtggacgacttcacccgactgactttggacacgattgca
ttgtgcgccatggactaccgcttcaactcatactactaccagaagatgcatccattcgtg
gatgccatgtcagatttcctgaaggtcagtggcgaccgagcccgaagagacccgatatca
cagatgttctaccgtgcagagactgcgaagtactgggaggacatcgaattattgcgaaaa
acgagtatggaagtcatcaagaacaggagagagaaccccacagaaaagaaggatctcctg
aatggcatgctgaacggagtggaccccaagacgggagagaagatgagtgatgagagcatc
atggacaacatgattaccttcttgatcgctggccacgagacgacgtctggacttctatca
tttacgttctactacctgctcaagaacccagctgcctacgagaaagcacaacaagaggtc
gacagcgtcattggaaagggaccgattaccgtggatcatttgtcgaaggtgccatttctc
aacgcagtgctccgagaatcccttcgtctttcgccaaccgcaccatccattggtttgacg
gcgaaacaggataccgtgcttggcggaaagtaccctgtcaaggcaggcgcgccaatcctc
acccttttccccttgattcatcgcgatccacttgcctacggagaagatgcagaagagttt
cgacctgagcgcatgttggatgaagaattcgaccgccgcaacaaggagtaccccaactgc
tggaagccttttggaaacggaatgcgagcttgtattggacgcccattcgcatggcaagaa
gccctacttgtgcttgcaattctcctgcagaatttcaacttctctatggatgatgcatca
tacaagctgcagatcaagcaaacacttactatcaagcccaaggatttctacatgcgcgcg
catctacggaacggcgtgtcggctaccagtcttgagcgagcacttcagtctgctactcta
caagagcctccacctgctaacggcggccaagcggtcaggaaacaaaaggcgaacaaaggg
aagccgatcgctatctactacggctccaacaccggcacatgcgaagctctcgcaaaccgg
cttgcaagtgatgctgcaaaccatggtttcagggctgatgttgtagacactctcgatgca
gcgcgcgagaacttgcctacagacaagccggtcgtcatggttactgcctcatacgaaggt
cagcctgcagataatgcagctcacttcgtcaactggatcggtacgctcaaagacaaggaa
ttggagaaagtctcgtatgccgtctttggatgcggtcaccgtgactgggccaagacgttc
cacaaagttccaaagtatctgaacactacgctcgaggaacgtggtgctacaaaattagtc
gagatgggcaccaccgatgccgcttcaggggacatctttacagactttgagacctgggaa
gatcaggttctatggcctgctctgcgtgaaaagtatggctcgtctgaggttgaaggcgaa
ggttcaatggaagctactctggacgtggacatcagcacacctcgatcaacgatcttgcgc
caagacgttcgcgaagcgcgtgtagaggaggttcaggtcttgagtgcaaacggtgttgcc
gaaaagaggcacattgagatcagcctgccatcggacatgtcgtactctgctggagattac
ttggcgatattgccgctcaacccgaaggagaacatccgtcgagctaccaagtacttcggt
ctatcgtgggatagcatgttgactattcagtccgctggcccaactacactgcccacggat
acacccatcagtgcagttgatgtcttcggcgcgtatgtggagcttgctcaaccagccagc
aagcgcaacattctcactctcgtcgacgcgactcgcgatgaagacacaaagacacaactc
ttgcgtctcgcagattccgctttcacagaggagatcactgcaaaacgtgtctctgtgctc
gaccttctcgagcgcttcccatccgtccagctgccacttggcgtcttcttgaagatgcag
ccaccgatgcgagtccgccagtacagcatctcctcgtcaccactctggaatccgaacaac
gtcaccctcacatacgccgttgtcaatcaacccgcactcagcggtcaaggacgctacgtc
ggtgtcgcaacaaaccatctctccaagctcgcacccggagacaagctccacgtcagcgtc
cgcgcatcccaccaagctttccatctccccaaggatgggaagtccatcccgattatctgt
atagccgccggtaccggcctcgctcccttccgtggcttcatccaagaacgcgctgctcaa
ctcgccgccgggcgcaccctcgcccctgcgctcctcttctacggctgccactctcccgac
agcgacctcttatattctgaccttctcaagaaatgggaacagctcggcgctgtatcccta
cgctttgcattctcgcgccagcccgaagcatctgaaggttgcaagtatgtgcaagatcgt
atgtatcacgaccgcgcggacatcatcgagttgttcaatcagggcgcgaagttgtttgtg
tgcggaagtcgggaggtgggagatggtgcggaggagatgttgattaagattgctaaggaa
aagtttcagggtgaggaggggagggaagccgatgataagaaggcgagggagtggtttgag
gatttgaggaatgagaggtttgcgacggatgtttttgcttga

DBGET integrated database retrieval system